Citrus Sinensis ID: 018319


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MEPLWKLLYLLEPAPVTLILTAVAVTFGSAFRALNYGKEMERNRDLSEASIMLDRSQALMIPVMSSCSLVLMFYLFSSVSQLLTALTAVASVSSLFFCLSPYIAHVRSQFGLADPFVSRCCSKSLTRIQWLLLLACTSVVVAWLVSGHWILNNLLGIAICIAFVSHVRLPNIKICAMLLVCLFVYDIFWVFFSERFFGANVMVSVATQQASNPVHTVANSLSLPGLQLITKKLELPVKIVFPRNLFGGVTPGGNATDFMMLGLGDMAMPAMLLALVLCFDHRKSSNTVSLFDLHSSKGHKYIWYALPGYAIGLVTALSAGVPSTLGPVIVMSWVRKDLDELWEGTLSNINDKSHQIEV
ccccccHHHEEHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHEEEEccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHEEEEcccccccccEEEEEECcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccc
**PLWKLLYLLEPAPVTLILTAVAVTFGSAFRALNYGKE**********SIMLDRSQALMIPVMSSCSLVLMFYLFSSVSQLLTALTAVASVSSLFFCLSPYIAHVRSQFGLADPFVSRCCSKSLTRIQWLLLLACTSVVVAWLVSGHWILNNLLGIAICIAFVSHVRLPNIKICAMLLVCLFVYDIFWVFFSERFFGANVMVSVATQQASNPVHTVANSLSLPGLQLITKKLELPVKIVFPRNLFGGVTPGGNATDFMMLGLGDMAMPAMLLALVLCFDHRKSSNTVSLFDLHSSKGHKYIWYALPGYAIGLVTALSAGVPSTLGPVIVMSWVRKDLDELWEGTLS***********
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPLWKLLYLLEPAPVTLILTAVAVTFGSAFRALNYGKEMERNRDLSEASIMLDRSQALMIPVMSSCSLVLMFYLFSSVSQLLTALTAVASVSSLFFCLSPYIAHVRSQFGLADPFVSRCCSKSLTRIQWLLLLACTSVVVAWLVSGHWILNNLLGIAICIAFVSHVRLPNIKICAMLLVCLFVYDIFWVFFSERFFGANVMVSVATQQASNPVHTVANSLSLPGLQLITKKLELPVKIVFPRNLFGGVTPGGNATDFMMLGLGDMAMPAMLLALVLCFDHRKSSNTVSLFDLHSSKGHKYIWYALPGYAIGLVTALSAGVPSTLGPVIVMSWVRKDLDELWEGTLSNINDKSHQIEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptide peptidase-like 1 Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.confidentQ7G7C7
Signal peptide peptidase-like 1 Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.confidentQ93Z32
Signal peptide peptidase-like 3 Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.probableQ9CUS9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HYG, chain A
Confidence level:confident
Coverage over the Query: 56-108,124-209,257-279,297-335
View the alignment between query and template
View the model in PyMOL