Citrus Sinensis ID: 018323

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MRTRGLILKSIARFIAYALCAADEALHDAKWLPSDQGQKERTGVSIGGGIGSISDTVDAAQMICEKRLRRLSPFFIPRILINMASGHVSMKYGFQGPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFVIGEGSGVLVLEELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLAIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
cccccHHHHcHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcHHHHHHHHHHcccccEEEEcccccccccHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccccEEcccccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccCEEEEccccccccccEEEEEEcc
***RGLILKSIARFIAYALCAADEALHDAKWLPSDQGQKERTGVSIGGGIGSISDTVDAAQMICEKRLRRLSPFFIPRILINMASGHVSMKYGFQGPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFVIGEGSGVLVLEELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLAIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTRGLILKSIARFIAYALCAADEALHDAKWLPSDQGQKERTGVSIGGGIGSISDTVDAAQMICEKRLRRLSPFFIPRILINMASGHVSMKYGFQGPNHAAVTACATGAHSIGDAARMIQFGDSDVMVAGGTESSIDALSMAGFCKSRALTTKYNGTPQEASRPFDCGRDGFVIGEGSGVLVLEELEHAKKRGAKIYAEVRGYGMSGDAHHITQPHIDGKGAILAMTRALKQSGLQSHQVDYVNAHATSTPLGDTVEATAIRTVFSDHATSGSLAFSSTKGAIGHLLGAAGAVEAIFAVLAIHHGVAPLTLNLAKPDPIFNDNFMPLTASKDMPISAALSNSFGFGGTNASLLFTKCQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial May play a role in the biosynthesis of lipoic acid as well as longer chain fatty acids required for optimal mitochondrial function.probableO94297
3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial Catalyzes all the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Able to elongate saturated acyl chains from 4 to at least 16 carbons. Uses malonyl-CoA but not acetyl-CoA as primer substrate. When expressed in a heterologous system, reveals a bimodal distribution of products, with peaks at C8 and C14-C16.probableQ8L3X9
3-oxoacyl-[acyl-carrier-protein] synthase 2 Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Has a preference for short chain acid substrates and may function to supply the octanoic substrates for lipoic acid biosynthesis.probableP56902

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.3.-.-Acyltransferases.probable
2.3.1.-Transferring groups other than amino-acyl groups.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DDO, chain A
Confidence level:very confident
Coverage over the Query: 3-358
View the alignment between query and template
View the model in PyMOL