Citrus Sinensis ID: 018331


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MHNIIEFTLQREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFLLSRLLLDDLKQSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGFAGGLNGLNSSSMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGIAFASLYPGCIATTGLFREHIPLFRLLFPPFQKYITKGYVSEDEAGKRLAQVVSDPSLTKSGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVGLA
cccccHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccc
*****************************************TLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFLLSRLLLDDLKQSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGFAGGLNGLNSSSMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGIAFASLYPGCIATTGLFREHIPLFRLLFPPFQKYITKGYVSEDEAGKRLAQVVSDPSLTKSGVYWSWNKDSA*************EKARKVWEISEKLVGLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNIIEFTLQREFSQRNGVVRAQTMATASPAVDVSSPQGKKTLRKGSVIITGASSGLGLATAKALAETGKWHIIMACRDFLKAERAAKSAGMAKENYTIMHLDLASLDSVRQFVDTFRRSGRPLDVLVCNAAVYLPTAKEPTFTAEGFELSVGTNHLGHFLLSRLLLDDLKQSDYPSKRLIIVGSITGNTNTLAGNVPPKANLGDLRGFAGGLNGLNSSSMIDGGDFDGAKAYKDSKVCNMLTMQEFHRRFHEETGIAFASLYPGCIATTGLFREHIPLFRLLFPPFQKYITKGYVSEDEAGKRLAQVVSDPSLTKSGVYWSWNKDSASFENQLSQEASDVEKARKVWEISEKLVGLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protochlorophyllide reductase A, chloroplastic Phototransformation of protochlorophyllide (Pchlide) to chlorophyllide (Chlide). PORA may also function as a photoprotectant during the transitory stage from dark to light.confidentQ42536
Protochlorophyllide reductase B, chloroplastic Phototransformation of protochlorophyllide (Pchlide) to chlorophyllide (Chlide).confidentQ8W3D9
Protochlorophyllide reductase A, chloroplastic Phototransformation of protochlorophyllide (Pchlide) to chlorophyllide (Chlide).confidentQ7XKF3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.3.-.-Acting on the CH-CH group of donors.probable
1.3.1.-10-hydroxytaxane O-acetyltransferase.probable
1.3.1.33Protochlorophyllide reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O26, chain A
Confidence level:very confident
Coverage over the Query: 45-275,294-323
View the alignment between query and template
View the model in PyMOL
Template: 3AWD, chain A
Confidence level:very confident
Coverage over the Query: 41-190,226-327
View the alignment between query and template
View the model in PyMOL
Template: 1W6U, chain A
Confidence level:very confident
Coverage over the Query: 41-190,226-354
View the alignment between query and template
View the model in PyMOL