Citrus Sinensis ID: 018351

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MFTCIACTKQMAEGGEEVEGGARGSGTPSTKEAVKSLTAQIKDMAIKISGYRQCKPCTGSSSYKKGQRPYPDYDMASEGVPYPYLGGGSSSSTPAWDFTSAGRHPTGRSDTRFMGVYSDDRTPRGLDTASVQSCDVVLEDEDEPKEWMAQVEPGVHITFLSLPNGGNDLKRIRFSREMFNKWQAQRWWGENYDRIMELYNVQRFNRQALNTPPRSEDEPRDSTYTRLGSARESPMSSSMNREWTPRNHYKPSGFDPHYNAGSSTYGGGGPRYEATSMDPSRTTTSSRDEPSVSVSNASEVEAEWVEQDEPGVYITIRQLADGSRELRRVRFSRERFGEVNAKTWWEENRERIQAQYL
cccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEECccCEEEEEEEcccccccCEEEEEEHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECccccEEEEEEEcccccEEEEEEEEcHHcccHHHHHHHHHHHHHHHHHHHc
MFTCIAC****************************SLTAQIKDMAIKISGYRQCK******************************************************************************************EWMAQVEPGVHITFLSLPNGGNDLKRIRFSREMFNKWQAQRWWGENYDRIMELYNVQ*****************************************************************************************************WVEQDEPGVYITIRQLADGSRELRRVRFSRERFGEVNAKTWWEENRERIQAQYL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTCIACTKQMAEGGEEVEGGARGSGTPSTKEAVKSLTAQIKDMAIKISGYRQCKPCTGSSSYKKGQRPYPDYDMASEGVPYPYLGGGSSSSTPAWDFTSAGRHPTGRSDTRFMGVYSDDRTPRGLDTASVQSCDVVLEDEDEPKEWMAQVEPGVHITFLSLPNGGNDLKRIRFSREMFNKWQAQRWWGENYDRIMELYNVQRFNRQALNTPPRSEDEPRDSTYTRLGSARESPMSSSMNREWTPRNHYKPSGFDPHYNAGSSTYGGGGPRYEATSMDPSRTTTSSRDEPSVSVSNASEVEAEWVEQDEPGVYITIRQLADGSRELRRVRFSRERFGEVNAKTWWEENRERIQAQYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BREVIS RADIX Acts as a regulator of cell proliferation and elongation in the root and shoot. Probable transcription regulator. Regulated by the auxin response factor ARF5. Polarly localized in vascular cells and subject to endocytic recycling. Required for CPD expression and for correct nuclear auxin response. Mediates cross-talk between the auxin and brassinosteroid pathways. BRX is a target for auxin-induced, proteasome-mediated degradation.probableQ17TI5
Protein Brevis radix-like 1 probableQ6YUB8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted