Citrus Sinensis ID: 018357


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MFQKGTTIGSSLGSGHIENWGESGIGDNSQQTDTSTDVDTDDKNQVNGVRRGVPIVTGSMEQSKIKTGDQKALRRLAQNREAARKSRLRKKAYVQQLENSRLRLAQLEQELQRARQQGIFIATGVSGDIGHSVAGNGVLAFDLDYVHWVDEHQRLINDLRSAVNSSMGDNELRHLVDGVMAHYEEVFQLKSIGTKADVFHMLSGMWKTPVERCFMWLGGFRSSELLKVIGNHLEPLTDQQLMGICNLQQSSQQAEDALSQGMEALQQSLVDTLSASSLGPTSSGNVADYMGQMALAMGKLATLENFIHQADLLRQQTLQQMHRILTARQAARALLVINDYTSRLRALSSLWLARPRG
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHcccc
********************************************************************************************YVQQLENSRLR**********ARQQGIFIATGVS*D*****AGNGVLAFDLDYVHWVDEHQRLINDLRSAVNSSMGDNELRHLVDGVMAHYEEVFQLKSIGTKADVFHMLSGMWKTPVERCFMWLGGFRSSELLKVIGNHLEPLTDQQLMGICNL*****************LQQSLVDTLS***********VADYMGQMALAMGKLATLENFIHQADLLRQQTLQQMHRILTARQAARALLVINDYTSRLRALSSLWLARP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQKGTTIGSSLGSGHIENWGESGIGDNSQQTDTSTDVDTDDKNQVNGVRRGVPIVTGSMEQSKIKTGDQKALRRLAQNREAARKSRLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxGIFIATGVSGDIGHSVAGNGVLAFDLDYVHWVDEHQRLINDLRSAVNSSMGDNELRHLVDGVMAHYEEVFQLKSIGTKADVFHMLSGMWKTPVERCFMWLGGFRSSELLKVIGNHLEPLTDQQLMGICNLQQSSQQAEDALSQGMEALQQSLVDTLSASSLGPTSSGNVADYMGQMALAMGKLATLENFIHQADLLRQQTLQQMHRILTARQAARALLVINDYTSRLRALSSLWLARPRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor PERIANTHIA Transcriptional activator involved in the determination of floral organ number. Acts to determine floral organ patterning by establishing floral organ primordia in specific numbers and positions. Plays a role in regulating stem cell fate by directly controlling AG expression. Binds to the 5'-AAGAAT-3' cis-acting element found in AG promoter. Might represent a target for a post-translational modification by GRXC7/ROXY1.probableQ9SX27
Transcription factor TGA2 Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Required to induce the systemic acquired resistance (SAR) via the regulation of pathogenesis-related genes expression. Binding to the as-1 element of PR-1 promoter is salicylic acid-inducible and mediated by NPR1. Could also bind to the C-boxes (5'-ATGACGTCAT-3') with high affinity.probableP43273
Transcription factor HBP-1b(c38) Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.probableP23923

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HJB, chain A
Confidence level:confident
Coverage over the Query: 69-116
View the alignment between query and template
View the model in PyMOL
Template: 2Y39, chain A
Confidence level:probable
Coverage over the Query: 223-277,288-340
View the alignment between query and template
View the model in PyMOL