Citrus Sinensis ID: 018366

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------

MRSLSEIQLPKQNNKYEEEESYSHAMQLAMGVVLPMATQAAIQLGVFEIIAKAGKLSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSSGERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFDSVPEGDAILMKWILHCWDDDHCLRILKNCYKAIPDNGKVIVMNSIVPEIPEVSSSARETSLLDVLLMTRDGGGRERTKKEFTELAIAAGFKHINFASCVCNLYIMEFFK

ccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHHccEEEEcccccccccccHHcccccccccccccHHHHHccccHHHHHHHHHHHHHHHcccccccccccccHHHHHcccccHHHHHHHHHHHcHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHcccccCEEEcccHHHHHccccccccEEEccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEEEEccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEEEcccccEEEEEEc

***********************HAMQLAMGVVLPMATQAAIQLGVFEIIAKAGKLSAPEIAAQLQAQNVKAPMMLDRMLRLLVSHRVLECSVSSGERLYGLTPVSKYFVSNKDGVSLGHFMALPLDKVFMESWLGLRDAVMEGGIPFNRVHGMHIFEYASGNPGFNETYHKAMFNHSTIAMERILEHYEGFQNVERLVDVGGGFGVTLSMITSKYPQIKAVNFDLPHVVQDAPSYAGVEHVGGNMFDSVPEGDAILMKWILHCWDDDHCLRILKNCYKAIPDNGKVIVMNSIVPEIPEVSSSARETSLLDVLLMTRDGGGRERTKKEFTELAIAAGFKHINFASCVCNLYIMEFFK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Flavone 3'-O-methyltransferase 1	Methylates OH residues of flavonoid compounds. Substrate preference is quercetin > myricetin >> luteolin. Dihydroquercetin is not a substrate.	probable	Q9FK25
Anthranilate N-methyltransferase	Involved in the biosynthesis of acridine alkaloids. N-methyltransferase with a strict substrate specificity for anthranilate. No activity with anthranilic acid methyl ester, anthraniloyl CoA, 3- or 4-amino-benzoic acid, salicylic acid, catechol, eugenol, caffeic acid, quercetin, theobromin, theophyllin, putrescine and nicotinic acid among others.	probable	A9X7L0
Caffeic acid 3-O-methyltransferase	Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.	probable	Q8W013

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.1.-.-	Transferring one-carbon groups.	probable
2.1.1.-	15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3REO, chain A
Confidence level:very confident
Coverage over the Query: 17-357
View the alignment between query and template
View the model in PyMOL