Citrus Sinensis ID: 018368

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MSIFFCWVAYLLLANSTFCASQMDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDAALQERNLATSEKKAAIAERDMAFLQRDTAIAERNNAILERDNAIASLQYRENSLGGNMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYSREMHTGDALPVSPGASEAAKPRRYKRAKEPKVLSPNKKTAKSPRKVKRENEDLNKVVFGKPSEWKSVQDLDGGDDDVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK
ccHHHHHHHHHHHHccHHHHHHcccccccccccccHHHHHHHHccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHcccccEEEEc
*SIFFCWVAYLLLANSTFC**************************WL****************************************AFLQRDTAIAERNNAILERDNAIASL***************************************************************************************************************************************GQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSMYPLPAVP*************GSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFFCWVAYLLLANSTFCASQMDDGGHRENGRHKADQYKAAQGQWLMHHQPSMKQIMTIMAERDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNAIASLQYRENSLGGNMSSCPPGCQISRGVKHMHHPQQHVHQLHHVSEAAYSREMHTGDALPVSPGASEAAKPRRYKRAKEPKVLSPNKKTAKSPRKVKRENEDLNKVVFGKPSEWKSVQDLDGGDDDVNKQSTASKSDWKGQVLGLNQVTFDESTMPPPACSCTGVLRQCYKWGNGGWQSACCTTSLSMYPLPAVPNKRHARVGGRKMSGSAFNKLLTRLAAEGHDLSHPVDLKDHWAKHGTNRYITIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Barley B recombinant-like protein D Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.probableQ5VSA8
Protein BASIC PENTACYSTEINE6 Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.probableQ8L999

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NMD, chain A
Confidence level:probable
Coverage over the Query: 68-85
View the alignment between query and template
View the model in PyMOL