Citrus Sinensis ID: 018408

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------

MRVATVLHHPVRPVPSYRSTLFTPSPAKMKTLRFSFSHRSTKFKVLAAKKQLPELRSRKQKQDGENLLSRDQKAEEGFDLGWLPAFPHVLIASMSNFLFGYHIGVMNGPIVSIAKELGFEGNPILEGLVVSIFIAGAFVGSISSGSLADKLGCRRTFQIDTIPLILGAIISAQAHSLDEMLWGRFLVGLGIGVNTVLVPIYISEVAPTKYRGSLGTLCQVGTCLGIITSLFLGIPAEDDPHWWRTMLYIASLPGFILALGMQFTVESPRWLCKGGMLNDAKAVIANLWGESEINKAIEEFQLVIKKDGSDLDSQWSELLEEPHSRVAFIGDGALASLLVGVTNFAGLRSEKYCGYV

cccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHcccccccEEEEEHHHHHHHHHHHHHHccccEEEEcccc

*******************************************************************************LGWLPAFPHVLIASMSNFLFGYHIGVMNGPIVSIAKELGFEGNPILEGLVVSIFIAGAFVGSISSGSLADKLGCRRTFQIDTIPLILGAIISAQAHSLDEMLWGRFLVGLGIGVNTVLVPIYISEVAPTKYRGSLGTLCQVGTCLGIITSLFLGIPAEDDPHWWRTMLYIASLPGFILALGMQFTVESPRWLCKGGMLNDAKAVIANLWGESEINKAIEEFQLVIKKDGSDLDSQWSELLEEPHSRVAFIGDGALASLLVGVTNFAGLRSEKYCGYV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable plastidic glucose transporter 1	May be involved in the efflux of glucose towards the cytosol.	probable	Q0WVE9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O7Q, chain A
Confidence level:confident
Coverage over the Query: 85-275,290-292,306-348
View the alignment between query and template
View the model in PyMOL

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 87-295
View the alignment between query and template
View the model in PyMOL