Citrus Sinensis ID: 018437

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEEITFTFISSLKVCPFLVL
ccccccccccccccccccccHHHHccccccccccccccHHHHHHHHHHHHHccccccccccEEEEccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccCEEECccHHHHHHHHHHHHHHHHHHHHHHccccccccCEEEccccHHcHHHHccccEEEEEEEEcccccEEEcHHHHHHHcccccEEEEEEcccccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccccEEEECccccccccccccEEEEEcccccccccEEEEccccccccccccEEcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccc
******************ASRYVRAAIPRF*M***SMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEEITFTFISSLKVCPFLVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTPIHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDELVFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEEITFTFISSLKVCPFLVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate decarboxylase 4 Catalyzes the production of GABA. The calmodulin-binding is calcium-dependent and it is proposed that this may, directly or indirectly, form a calcium regulated control of GABA biosynthesis.probableQ9ZPS3
Glutamate decarboxylase A Generates GABA from glutamate. GABA induces the release of acbA from prespore cells and induces the exposure of tagC on the surface of prestalk cells where it can convert acbA to SDF-2. Glutamate acts as a competitive inhibitor.probableQ54VQ5
Glutamate decarboxylase Catalyzes the production of GABA. The calmodulin-binding is calcium-dependent and it is proposed that this may, directly or indirectly, form a calcium regulated control of GABA biosynthesis.probableP54767

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.1.-.-Carbon-carbon lyases.probable
4.1.1.-Carboxy-lyases.probable
4.1.1.15Glutamate decarboxylase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HBX, chain A
Confidence level:very confident
Coverage over the Query: 12-355
View the alignment between query and template
View the model in PyMOL