Citrus Sinensis ID: 018448

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MATGTATAPRQLSQKEADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIRPGHKWDVMVDLFFYREPEETKQAEEEETAAIDYATAEYNTNLTSGDQWPSQIADGGWAGGEVQKPIPGVPYFPEAAPAATVPLGGDGWDAVPAPPMAALQLLMFLLPHHLLDGTNFILREFCFNHFKPLLLQLCVSLNFFMFCKELWLFSFFFWHSYSSRH

cccccccccccccccHHHHHHHHHcccccccccccccccccEEEEEccccEEEEHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHcccccEEEEEccccccccEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc

***************EADIQMMLAAEVHLGTKNCDFQMERYVFKRRNDGIYIINLGKTWEKLQMAARVIVAIENPGDIIVQSARPYGQRAVLKFAKYTHAHAIAGRHTPGTFTNQMQTSFNEPRLLILTDPRTDHQPIKEAALGNIPTIAFCDTDSPMRYVDIGIPANNKGKHSIGCLFWLLARMVLQMRGTIRPGHKWDVMVDLFFYREP******************AEYNTNLTSGDQWPSQIADGGWAGGEVQKPIPGVPYFPEAAPAATVPLGGDGWDAVPAPPMAALQLLMFLLPHHLLDGTNFILREFCFNHFKPLLLQLCVSLNFFMFCKELWLFSFFFWHSYS***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
40S ribosomal protein SA	Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.	probable	A5BUU4
40S ribosomal protein Sa-2	Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.	probable	Q8H173
40S ribosomal protein SA	Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis.	probable	B5FXT6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain A
Confidence level:very confident
Coverage over the Query: 12-254
View the alignment between query and template
View the model in PyMOL