Citrus Sinensis ID: 018454

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MAKTKEKKVNVSGKPKHSLDANRTDGKSGSRSASTVRRLNMYKTRPKRDRKGKVLQHEFQSKELPNTRIQPDRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDHQKQARVHLLDTEPFQDAFGPKGKRKRPKLLASDYESLVKRADGSQDAFEQKNDASTSAEGVEGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVILFFPASVVWYWFYCQLLFYFGEW
ccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccHHHccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHcccccccHHHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHccccccccccccccEEEEEEEEEEEEccc
**********************************TVRRLNMYKTRPKRDR**KV***************Q*DRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDH****RVHLL********************************************************FRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVILFFPASVVWYWFYCQLLFYFGEW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKTKEKKVNVSGKPKHSLDANRTDGKSGSRSASTVRRLNMYKTRPKRDRKGKVLQHEFQSKELPNTRIQPDRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDHQKQARVHLLDTEPFQDAFGPKGKRKRPKLLASDYESLVKRADGSQDAFEQKNDASTSAEGVEGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVILFFPASVVWYWFYCQLLFYFGEW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleolar GTP-binding protein 2 GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation.probableQ6C036
Nucleolar GTP-binding protein 2 GTPase that associates with pre-60S ribosomal subunits in the nucleolus and is required for their nuclear export and maturation.probableO14236

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PUJ, chain A
Confidence level:very confident
Coverage over the Query: 198-340
View the alignment between query and template
View the model in PyMOL
Template: 3H2Y, chain A
Confidence level:very confident
Coverage over the Query: 182-188,206-338
View the alignment between query and template
View the model in PyMOL