Citrus Sinensis ID: 018454
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 355 | ||||||
| 225461399 | 530 | PREDICTED: nucleolar GTP-binding protein | 0.969 | 0.649 | 0.853 | 1e-173 | |
| 147775210 | 530 | hypothetical protein VITISV_000763 [Viti | 0.969 | 0.649 | 0.850 | 1e-172 | |
| 354464677 | 567 | GTP-binding family protein [Carica papay | 0.969 | 0.606 | 0.844 | 1e-170 | |
| 224128358 | 554 | predicted protein [Populus trichocarpa] | 0.969 | 0.620 | 0.822 | 1e-169 | |
| 356549741 | 549 | PREDICTED: nucleolar GTP-binding protein | 0.969 | 0.626 | 0.839 | 1e-169 | |
| 356544026 | 549 | PREDICTED: nucleolar GTP-binding protein | 0.969 | 0.626 | 0.836 | 1e-168 | |
| 449449188 | 557 | PREDICTED: nucleolar GTP-binding protein | 0.969 | 0.617 | 0.813 | 1e-165 | |
| 449492670 | 557 | PREDICTED: LOW QUALITY PROTEIN: nucleola | 0.969 | 0.617 | 0.813 | 1e-165 | |
| 255575328 | 559 | GTP-binding protein, putative [Ricinus c | 0.957 | 0.608 | 0.816 | 1e-160 | |
| 255550774 | 537 | GTP-binding protein, putative [Ricinus c | 0.957 | 0.633 | 0.790 | 1e-156 |
| >gi|225461399|ref|XP_002284849.1| PREDICTED: nucleolar GTP-binding protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 613 bits (1581), Expect = e-173, Method: Compositional matrix adjust.
Identities = 296/347 (85%), Positives = 315/347 (90%), Gaps = 3/347 (0%)
Query: 1 MAKTKEKKVNVSGKPKHSLDANRTDGKSGSRSASTVRRLNMYKTRPKRDRKGKVLQHEFQ 60
MAK KE+KVNVSGKPKHSLD NR +G RSA+TVRRL MY TRPKRDRKGK+L+HE Q
Sbjct: 1 MAKKKERKVNVSGKPKHSLDVNRGNGDKEGRSAATVRRLKMYNTRPKRDRKGKILKHELQ 60
Query: 61 SKELPNTRIQPDRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDHQ 120
SKELP+TRIQPDRRWFGNTR VNQK+LEFFREELQS MSSSYNVIL+EKKLP SLLNDHQ
Sbjct: 61 SKELPSTRIQPDRRWFGNTRVVNQKELEFFREELQSRMSSSYNVILKEKKLPMSLLNDHQ 120
Query: 121 KQARVHLLDTEPFQDAFGPKGKRKRPKLLASDYESLVKRADGSQDAFEQKNDASTSAEGV 180
KQARVHLLDTEPF+DAFGPK KR RPKL+A DYESLVK+ADGSQDAFEQK+ S AEG
Sbjct: 121 KQARVHLLDTEPFEDAFGPKKKRIRPKLMAMDYESLVKKADGSQDAFEQKHAGSAYAEGS 180
Query: 181 EGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEH 240
EGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRC+HLE+HLKEH
Sbjct: 181 EGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCYHLEKHLKEH 240
Query: 241 CKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARL 300
CKHKHMILLLNKCDL+PAWATKGWLRVLSKE+P+LAFHASINKSFGKGSLLSVLRQFARL
Sbjct: 241 CKHKHMILLLNKCDLIPAWATKGWLRVLSKEFPTLAFHASINKSFGKGSLLSVLRQFARL 300
Query: 301 KSDKQAISVGFVGYPNVGKSSVINTLRTKNVILFFP---ASVVWYWF 344
KSDKQAISVGFVGYPNVGKSSVINTLRTKNV P + VW +
Sbjct: 301 KSDKQAISVGFVGYPNVGKSSVINTLRTKNVCKVAPIPGETKVWQYI 347
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147775210|emb|CAN68109.1| hypothetical protein VITISV_000763 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|354464677|gb|AER26534.1| GTP-binding family protein [Carica papaya] | Back alignment and taxonomy information |
|---|
| >gi|224128358|ref|XP_002329142.1| predicted protein [Populus trichocarpa] gi|222869811|gb|EEF06942.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356549741|ref|XP_003543249.1| PREDICTED: nucleolar GTP-binding protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356544026|ref|XP_003540457.1| PREDICTED: nucleolar GTP-binding protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449449188|ref|XP_004142347.1| PREDICTED: nucleolar GTP-binding protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449492670|ref|XP_004159067.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar GTP-binding protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255575328|ref|XP_002528567.1| GTP-binding protein, putative [Ricinus communis] gi|223532011|gb|EEF33822.1| GTP-binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255550774|ref|XP_002516435.1| GTP-binding protein, putative [Ricinus communis] gi|223544255|gb|EEF45776.1| GTP-binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 355 | ||||||
| TAIR|locus:2011561 | 576 | AtNug2 "AT1G52980" [Arabidopsi | 0.963 | 0.593 | 0.8 | 7.3e-146 | |
| UNIPROTKB|Q10LF7 | 535 | Os03g0352400 "Os03g0352400 pro | 0.966 | 0.641 | 0.752 | 1.6e-141 | |
| UNIPROTKB|A8ITK3 | 472 | CHLREDRAFT_128793 "Predicted p | 0.969 | 0.728 | 0.604 | 5.7e-107 | |
| UNIPROTKB|E1BVP8 | 722 | GNL2 "Uncharacterized protein" | 0.971 | 0.477 | 0.511 | 1.7e-91 | |
| RGD|1305006 | 734 | Gnl2 "guanine nucleotide bindi | 0.974 | 0.471 | 0.501 | 1.9e-90 | |
| UNIPROTKB|F1MDN8 | 732 | GNL2 "Uncharacterized protein" | 0.974 | 0.472 | 0.498 | 1.7e-89 | |
| DICTYBASE|DDB_G0280289 | 986 | DDB_G0280289 "Nucleolar GTP-bi | 0.949 | 0.341 | 0.513 | 2.8e-89 | |
| UNIPROTKB|Q13823 | 731 | GNL2 "Nucleolar GTP-binding pr | 0.974 | 0.473 | 0.492 | 3.6e-89 | |
| MGI|MGI:2385207 | 728 | Gnl2 "guanine nucleotide bindi | 0.974 | 0.475 | 0.495 | 5.9e-89 | |
| UNIPROTKB|F1PYL5 | 731 | GNL2 "Uncharacterized protein" | 0.974 | 0.473 | 0.492 | 9.6e-89 |
| TAIR|locus:2011561 AtNug2 "AT1G52980" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1425 (506.7 bits), Expect = 7.3e-146, P = 7.3e-146
Identities = 280/350 (80%), Positives = 307/350 (87%)
Query: 1 MAKTKEKKVNVSGKPKHSLDANRTDGK---SGSRSASTVRRLNMYKTRPKRDRKGKVLQH 57
M K KEKK NVSGKPKHSLDANR DGK + +RS STV RL MYKTRPKR+ GK+L +
Sbjct: 1 MVK-KEKKANVSGKPKHSLDANRADGKKKTTETRSKSTVNRLKMYKTRPKRNAGGKILSN 59
Query: 58 EFQSKELPNTRIQPDRRWFGNTRCVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLN 117
E+QSKELPN+RI PDRRWFGNTR VNQK+LE+FREELQ+ MSS+YNVIL+E+KLP SLL
Sbjct: 60 EYQSKELPNSRIAPDRRWFGNTRVVNQKELEYFREELQTKMSSNYNVILKERKLPMSLLT 119
Query: 118 DHQKQARVHLLDTEPFQDAFGPKGKRKRPKLLASDYESLVKRADGSQDAFEQKNDASTSA 177
D++KQ+RVHLLD EPFQDAFG K KRKRPKL+ASDYE+LVK+A SQDAFE+KN A S
Sbjct: 120 DNKKQSRVHLLDMEPFQDAFGRKTKRKRPKLVASDYEALVKKAAESQDAFEEKNGAGPSG 179
Query: 178 EG-VEGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERH 236
EG E DGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDV+VQV+DARDPQGTRCHHLE+
Sbjct: 180 EGGEEEDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVIVQVIDARDPQGTRCHHLEKT 239
Query: 237 LKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQ 296
LKEH KHKHMILLLNKCDLVPAWATKGWLRVLSKEYP+LAFHAS+NKSFGKGSLLSVLRQ
Sbjct: 240 LKEHHKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPTLAFHASVNKSFGKGSLLSVLRQ 299
Query: 297 FARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVILFFPA---SVVWYW 343
FARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNV P + VW +
Sbjct: 300 FARLKSDKQAISVGFVGYPNVGKSSVINTLRTKNVCKVAPIPGETKVWQY 349
|
|
| UNIPROTKB|Q10LF7 Os03g0352400 "Os03g0352400 protein" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8ITK3 CHLREDRAFT_128793 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVP8 GNL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1305006 Gnl2 "guanine nucleotide binding protein-like 2 (nucleolar)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MDN8 GNL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0280289 DDB_G0280289 "Nucleolar GTP-binding protein 2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13823 GNL2 "Nucleolar GTP-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385207 Gnl2 "guanine nucleotide binding protein-like 2 (nucleolar)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PYL5 GNL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00027646001 | SubName- Full=Chromosome chr19 scaffold_4, whole genome shotgun sequence; (526 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00038895001 | • | • | • | 0.945 | |||||||
| GSVIVG00020673001 | • | • | • | 0.916 | |||||||
| GSVIVG00028735001 | • | • | • | 0.875 | |||||||
| GSVIVG00019376001 | • | • | • | 0.862 | |||||||
| GSVIVG00019318001 | • | • | • | 0.840 | |||||||
| GSVIVG00021672001 | • | • | 0.836 | ||||||||
| GSVIVG00021307001 | • | • | • | 0.831 | |||||||
| GSVIVG00031075001 | • | • | • | • | 0.823 | ||||||
| GSVIVG00017910001 | • | • | • | 0.822 | |||||||
| GSVIVG00036355001 | • | • | 0.813 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 355 | |||
| cd01858 | 157 | cd01858, NGP_1, A novel nucleolar GTP-binding prot | 3e-88 | |
| pfam08153 | 130 | pfam08153, NGP1NT, NGP1NT (NUC091) domain | 2e-57 | |
| cd04178 | 171 | cd04178, Nucleostemin_like, A circularly permuted | 2e-40 | |
| COG1161 | 322 | COG1161, COG1161, Predicted GTPases [General funct | 2e-36 | |
| cd01849 | 146 | cd01849, YlqF_related_GTPase, Circularly permuted | 5e-36 | |
| cd01857 | 140 | cd01857, HSR1_MMR1, A circularly permuted subfamil | 2e-31 | |
| cd01859 | 157 | cd01859, MJ1464, An uncharacterized, circularly pe | 1e-28 | |
| cd01856 | 171 | cd01856, YlqF, Circularly permuted YlqF GTPase | 4e-16 | |
| TIGR03596 | 276 | TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi | 7e-13 | |
| PRK09563 | 287 | PRK09563, rbgA, GTPase YlqF; Reviewed | 3e-11 | |
| cd01855 | 191 | cd01855, YqeH, Circularly permuted YqeH GTPase | 2e-09 | |
| TIGR03597 | 360 | TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase | 1e-07 | |
| pfam01926 | 117 | pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | 3e-06 | |
| COG1160 | 444 | COG1160, COG1160, Predicted GTPases [General funct | 8e-06 | |
| pfam01926 | 117 | pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | 1e-04 | |
| PRK00093 | 435 | PRK00093, PRK00093, GTP-binding protein Der; Revie | 1e-04 | |
| cd00882 | 161 | cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s | 2e-04 | |
| cd04164 | 159 | cd04164, trmE, trmE is a tRNA modification GTPase | 4e-04 | |
| TIGR03594 | 429 | TIGR03594, GTPase_EngA, ribosome-associated GTPase | 8e-04 | |
| cd01854 | 211 | cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y | 0.001 | |
| cd01898 | 170 | cd01898, Obg, Obg GTPase | 0.002 | |
| cd01897 | 167 | cd01897, NOG, Nucleolar GTP-binding protein (NOG) | 0.004 | |
| TIGR03598 | 178 | TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi | 0.004 |
| >gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
Score = 261 bits (670), Expect = 3e-88
Identities = 92/127 (72%), Positives = 112/127 (88%)
Query: 205 ELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGW 264
ELYKVIDSSDV++QVLDARDP GTRC H+E++L++ HKH+I +LNKCDLVP W TK W
Sbjct: 1 ELYKVIDSSDVIIQVLDARDPMGTRCKHVEKYLRKEKPHKHLIFVLNKCDLVPTWVTKRW 60
Query: 265 LRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKSSVIN 324
++VLSKEYP+LAFHASI FGKG+L+++LRQFA+L SDK+ ISVGF+GYPNVGKSSVIN
Sbjct: 61 VKVLSKEYPTLAFHASITNPFGKGALINLLRQFAKLHSDKKQISVGFIGYPNVGKSSVIN 120
Query: 325 TLRTKNV 331
TLR+K V
Sbjct: 121 TLRSKKV 127
|
Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus. Length = 157 |
| >gnl|CDD|149291 pfam08153, NGP1NT, NGP1NT (NUC091) domain | Back alignment and domain information |
|---|
| >gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|213834 TIGR03597, GTPase_YqeH, ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) | Back alignment and domain information |
|---|
| >gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases | Back alignment and domain information |
|---|
| >gnl|CDD|206685 cd01898, Obg, Obg GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) | Back alignment and domain information |
|---|
| >gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 355 | |||
| KOG2423 | 572 | consensus Nucleolar GTPase [General function predi | 100.0 | |
| PF08153 | 130 | NGP1NT: NGP1NT (NUC091) domain; InterPro: IPR01297 | 100.0 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 99.97 | |
| KOG2484 | 435 | consensus GTPase [General function prediction only | 99.96 | |
| KOG1424 | 562 | consensus Predicted GTP-binding protein MMR1 [Gene | 99.96 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 99.96 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 99.94 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 99.94 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 99.94 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 99.94 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 99.94 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 99.92 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 99.92 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 99.9 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 99.89 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 99.89 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 99.88 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 99.8 | |
| KOG2485 | 335 | consensus Conserved ATP/GTP binding protein [Gener | 99.77 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 99.76 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 99.76 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 99.75 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 99.75 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 99.73 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 99.7 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 99.69 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 99.69 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 99.52 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 99.48 | |
| KOG1249 | 572 | consensus Predicted GTPases [General function pred | 99.23 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 99.01 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 98.95 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 98.91 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 98.88 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 98.88 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 98.85 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 98.83 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 98.77 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 98.75 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 98.74 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 98.74 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 98.72 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 98.7 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 98.69 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 98.69 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 98.67 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 98.66 | |
| cd04165 | 224 | GTPBP1_like GTPBP1-like. Mammalian GTP binding pro | 98.65 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 98.65 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 98.64 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 98.63 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 98.62 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 98.61 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 98.61 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 98.6 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 98.6 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 98.59 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 98.58 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 98.57 | |
| PRK15467 | 158 | ethanolamine utilization protein EutP; Provisional | 98.56 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 98.55 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 98.53 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 98.5 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 98.5 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 98.49 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 98.49 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 98.48 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 98.47 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 98.46 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 98.46 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 98.45 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 98.43 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 98.41 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 98.41 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 98.41 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 98.4 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 98.39 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 98.38 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 98.38 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 98.38 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 98.36 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 98.36 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 98.34 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 98.33 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 98.33 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 98.32 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 98.32 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 98.32 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 98.32 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 98.31 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 98.31 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 98.31 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 98.3 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 98.29 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 98.28 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 98.28 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 98.27 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 98.26 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 98.26 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 98.26 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 98.26 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 98.26 | |
| PTZ00099 | 176 | rab6; Provisional | 98.26 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 98.26 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 98.25 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 98.25 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 98.25 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 98.25 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 98.25 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 98.24 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 98.24 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 98.24 | |
| PRK13768 | 253 | GTPase; Provisional | 98.24 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 98.24 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 98.24 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 98.24 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 98.23 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 98.23 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 98.23 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 98.23 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 98.23 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 98.23 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 98.23 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 98.22 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 98.22 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 98.22 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 98.22 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 98.21 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 98.21 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 98.21 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 98.21 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 98.2 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 98.2 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 98.2 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 98.19 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 98.19 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 98.19 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 98.18 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 98.18 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 98.18 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 98.17 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 98.17 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 98.17 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 98.16 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 98.16 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 98.16 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 98.15 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 98.15 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 98.15 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 98.15 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 98.14 | |
| cd01873 | 195 | RhoBTB RhoBTB subfamily. Members of the RhoBTB sub | 98.14 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 98.14 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 98.13 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 98.13 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 98.13 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 98.12 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 98.12 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 98.12 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 98.11 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 98.08 | |
| COG4917 | 148 | EutP Ethanolamine utilization protein [Amino acid | 98.08 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 98.08 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 98.08 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 98.08 | |
| cd04133 | 176 | Rop_like Rop subfamily. The Rop (Rho-related prote | 98.08 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 98.07 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 98.07 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 98.07 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 98.06 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 98.06 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 98.05 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 98.05 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 98.05 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 98.04 | |
| smart00176 | 200 | RAN Ran (Ras-related nuclear proteins) /TC4 subfam | 98.04 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 98.04 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 98.04 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 98.04 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 98.04 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 98.03 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 98.03 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 98.03 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 98.03 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 98.02 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 98.02 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 98.02 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 98.02 | |
| cd01883 | 219 | EF1_alpha Eukaryotic elongation factor 1 (EF1) alp | 98.01 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 98.01 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 98.0 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 98.0 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 98.0 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 97.99 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 97.99 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 97.98 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 97.97 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 97.97 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 97.97 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 97.96 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 97.95 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 97.95 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 97.94 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 97.94 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 97.93 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 97.92 | |
| PLN03118 | 211 | Rab family protein; Provisional | 97.92 | |
| KOG1489 | 366 | consensus Predicted GTP-binding protein (ODN super | 97.91 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 97.91 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 97.9 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 97.89 | |
| CHL00071 | 409 | tufA elongation factor Tu | 97.89 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 97.89 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 97.88 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 97.87 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 97.87 | |
| TIGR00437 | 591 | feoB ferrous iron transporter FeoB. FeoB (773 amin | 97.87 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 97.87 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 97.86 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 97.85 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 97.85 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 97.83 | |
| PLN03108 | 210 | Rab family protein; Provisional | 97.82 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 97.81 | |
| KOG0462 | 650 | consensus Elongation factor-type GTP-binding prote | 97.81 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 97.8 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 97.79 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 97.78 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 97.78 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 97.77 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 97.77 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 97.77 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 97.76 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 97.75 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 97.72 | |
| KOG1489 | 366 | consensus Predicted GTP-binding protein (ODN super | 97.72 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 97.71 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 97.71 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 97.71 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 97.7 | |
| KOG0075 | 186 | consensus GTP-binding ADP-ribosylation factor-like | 97.7 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 97.67 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 97.66 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.66 | |
| COG0536 | 369 | Obg Predicted GTPase [General function prediction | 97.64 | |
| KOG1490 | 620 | consensus GTP-binding protein CRFG/NOG1 (ODN super | 97.63 | |
| COG2229 | 187 | Predicted GTPase [General function prediction only | 97.62 | |
| KOG0078 | 207 | consensus GTP-binding protein SEC4, small G protei | 97.6 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 97.58 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 97.58 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 97.56 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 97.56 | |
| KOG1491 | 391 | consensus Predicted GTP-binding protein (ODN super | 97.56 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 97.56 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 97.53 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 97.53 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 97.51 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 97.5 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 97.49 | |
| KOG0094 | 221 | consensus GTPase Rab6/YPT6/Ryh1, small G protein s | 97.45 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 97.44 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 97.42 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 97.4 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 97.4 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 97.39 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 97.39 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 97.38 | |
| PRK00741 | 526 | prfC peptide chain release factor 3; Provisional | 97.38 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 97.36 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 97.32 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 97.31 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 97.27 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 97.25 | |
| KOG0092 | 200 | consensus GTPase Rab5/YPT51 and related small G pr | 97.21 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 97.2 | |
| COG5257 | 415 | GCD11 Translation initiation factor 2, gamma subun | 97.2 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 97.18 | |
| KOG1145 | 683 | consensus Mitochondrial translation initiation fac | 97.18 | |
| KOG0084 | 205 | consensus GTPase Rab1/YPT1, small G protein superf | 97.14 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 97.13 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 97.11 | |
| PLN03118 | 211 | Rab family protein; Provisional | 97.11 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 97.1 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 97.1 | |
| COG0481 | 603 | LepA Membrane GTPase LepA [Cell envelope biogenesi | 97.1 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 97.08 | |
| KOG0072 | 182 | consensus GTP-binding ADP-ribosylation factor-like | 97.08 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 97.05 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 97.05 | |
| KOG1144 | 1064 | consensus Translation initiation factor 5B (eIF-5B | 97.02 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 97.01 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 96.97 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 96.97 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 96.96 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 96.95 | |
| COG0370 | 653 | FeoB Fe2+ transport system protein B [Inorganic io | 96.94 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 96.93 | |
| COG1217 | 603 | TypA Predicted membrane GTPase involved in stress | 96.89 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 96.87 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 96.83 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 96.82 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 96.8 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 96.78 | |
| KOG1249 | 572 | consensus Predicted GTPases [General function pred | 96.71 | |
| KOG0073 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 96.7 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 96.68 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 96.63 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 96.59 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 96.58 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 96.54 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 96.51 | |
| COG2895 | 431 | CysN GTPases - Sulfate adenylate transferase subun | 96.51 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 96.5 | |
| KOG0088 | 218 | consensus GTPase Rab21, small G protein superfamil | 96.47 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 96.46 | |
| PF06858 | 58 | NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte | 96.44 | |
| KOG0093 | 193 | consensus GTPase Rab3, small G protein superfamily | 96.41 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 96.41 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 96.38 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 96.31 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 96.26 | |
| KOG0095 | 213 | consensus GTPase Rab30, small G protein superfamil | 96.25 | |
| KOG0076 | 197 | consensus GTP-binding ADP-ribosylation factor-like | 96.22 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 96.18 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 96.18 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 96.17 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 96.13 | |
| KOG0395 | 196 | consensus Ras-related GTPase [General function pre | 96.11 | |
| KOG0461 | 522 | consensus Selenocysteine-specific elongation facto | 96.09 | |
| KOG0077 | 193 | consensus Vesicle coat complex COPII, GTPase subun | 96.04 | |
| CHL00071 | 409 | tufA elongation factor Tu | 96.03 | |
| KOG0070 | 181 | consensus GTP-binding ADP-ribosylation factor Arf1 | 96.01 | |
| KOG2486 | 320 | consensus Predicted GTPase [General function predi | 95.99 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 95.95 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 95.92 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 95.9 | |
| PLN00116 | 843 | translation elongation factor EF-2 subunit; Provis | 95.87 | |
| KOG0098 | 216 | consensus GTPase Rab2, small G protein superfamily | 95.81 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 95.81 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 95.79 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 95.79 | |
| PTZ00416 | 836 | elongation factor 2; Provisional | 95.75 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 95.64 | |
| smart00053 | 240 | DYNc Dynamin, GTPase. Large GTPases that mediate v | 95.62 | |
| KOG0071 | 180 | consensus GTP-binding ADP-ribosylation factor Arf6 | 95.59 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 95.56 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 95.56 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 95.52 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 95.51 | |
| KOG0083 | 192 | consensus GTPase Rab26/Rab37, small G protein supe | 95.51 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 95.46 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 95.36 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 95.18 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 95.09 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 95.09 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 95.04 | |
| KOG0091 | 213 | consensus GTPase Rab39, small G protein superfamil | 95.0 | |
| KOG1486 | 364 | consensus GTP-binding protein DRG2 (ODN superfamil | 94.99 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 94.97 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.96 | |
| KOG0079 | 198 | consensus GTP-binding protein H-ray, small G prote | 94.87 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 94.74 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.73 | |
| KOG0087 | 222 | consensus GTPase Rab11/YPT3, small G protein super | 94.63 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 94.6 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 94.56 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 94.54 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 94.54 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 94.54 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 94.36 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 94.36 | |
| KOG0073 | 185 | consensus GTP-binding ADP-ribosylation factor-like | 94.3 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 94.28 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.25 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 94.25 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 94.24 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 94.21 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 94.17 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 94.1 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 94.1 | |
| COG4108 | 528 | PrfC Peptide chain release factor RF-3 [Translatio | 94.09 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 93.99 | |
| KOG1490 | 620 | consensus GTP-binding protein CRFG/NOG1 (ODN super | 93.97 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 93.97 | |
| KOG0458 | 603 | consensus Elongation factor 1 alpha [Translation, | 93.91 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 93.9 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 93.69 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 93.68 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 93.68 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 93.67 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 93.54 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 93.46 | |
| KOG0394 | 210 | consensus Ras-related GTPase [General function pre | 93.44 | |
| KOG0468 | 971 | consensus U5 snRNP-specific protein [Translation, | 93.41 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 93.18 | |
| PRK06696 | 223 | uridine kinase; Validated | 93.15 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 92.96 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.94 | |
| PF09439 | 181 | SRPRB: Signal recognition particle receptor beta s | 92.85 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 92.84 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 92.81 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 92.79 | |
| KOG0057 | 591 | consensus Mitochondrial Fe/S cluster exporter, ABC | 92.76 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 92.74 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 92.68 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 92.64 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 92.63 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 92.59 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 92.59 | |
| TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 92.58 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 92.55 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 92.53 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 92.5 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 92.44 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 92.38 | |
| KOG0054 | 1381 | consensus Multidrug resistance-associated protein/ | 92.36 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 92.3 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 92.29 | |
| KOG0448 | 749 | consensus Mitofusin 1 GTPase, involved in mitochon | 92.22 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 92.19 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 92.17 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 92.17 | |
| COG0050 | 394 | TufB GTPases - translation elongation factors [Tra | 92.16 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 92.1 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 92.1 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 92.1 | |
| PF04670 | 232 | Gtr1_RagA: Gtr1/RagA G protein conserved region; I | 92.07 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 92.06 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 92.05 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 92.03 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 92.03 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 92.03 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 91.95 | |
| COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 91.93 | |
| PLN00023 | 334 | GTP-binding protein; Provisional | 91.93 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 91.91 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 91.9 | |
| PLN02772 | 398 | guanylate kinase | 91.88 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 91.87 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 91.85 | |
| cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 91.85 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 91.83 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 91.82 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 91.8 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 91.79 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 91.77 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 91.77 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 91.75 | |
| KOG0081 | 219 | consensus GTPase Rab27, small G protein superfamil | 91.74 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 91.72 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 91.68 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 91.67 | |
| KOG0070 | 181 | consensus GTP-binding ADP-ribosylation factor Arf1 | 91.65 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 91.64 | |
| KOG0393 | 198 | consensus Ras-related small GTPase, Rho type [Gene | 91.62 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 91.61 | |
| COG0523 | 323 | Putative GTPases (G3E family) [General function pr | 91.61 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 91.61 | |
| cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 91.6 | |
| cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 91.59 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 91.56 | |
| cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 91.54 | |
| KOG0080 | 209 | consensus GTPase Rab18, small G protein superfamil | 91.52 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 91.52 | |
| PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 91.52 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 91.52 | |
| PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 91.51 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 91.5 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 91.5 | |
| cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 91.48 | |
| PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 91.47 | |
| cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 91.47 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 91.42 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 91.39 | |
| PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 91.36 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 91.36 | |
| TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 91.32 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 91.32 | |
| COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 91.3 | |
| PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 91.29 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 91.28 | |
| TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 91.23 | |
| PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 91.21 | |
| COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 91.18 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 91.14 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 91.14 | |
| PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 91.12 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 91.08 | |
| PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 91.07 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 91.06 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 91.06 | |
| cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 91.05 | |
| KOG2655 | 366 | consensus Septin family protein (P-loop GTPase) [C | 91.02 | |
| PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 91.01 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 91.01 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 91.01 | |
| cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 90.99 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 90.98 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 90.98 | |
| PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 90.96 |
| >KOG2423 consensus Nucleolar GTPase [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-112 Score=823.42 Aligned_cols=344 Identities=57% Similarity=0.933 Sum_probs=331.9
Q ss_pred cccccccCCCCCCCCCCCCCC--CCCCcccHHhhhhhhhccC-CcCCCCCCCeecc-cccCCCCCCccccCCCcccccee
Q 018454 5 KEKKVNVSGKPKHSLDANRTD--GKSGSRSASTVRRLNMYKT-RPKRDRKGKVLQH-EFQSKELPNTRIQPDRRWFGNTR 80 (355)
Q Consensus 5 ~~~~~~~~~~~~~~~~~~r~~--~~~~~r~~~~~~~l~m~~~-~~~r~~~g~~~~~-~~~~~~~~~~ri~p~r~wf~ntr 80 (355)
++++.+.+..++||+||+|.. |+++||+++||+|||||++ ||+||+.|+|+++ +||++.+|.||||||||||||||
T Consensus 5 ~k~k~~~~~~~~hs~np~r~~~k~~~~~r~k~tv~rL~Myrs~k~krns~Gkil~~a~fQss~~~~aRieP~rkWFgntR 84 (572)
T KOG2423|consen 5 KKEKSRTIRESKHSTNPGRLRGKGENNYRNKKTVKRLNMYRSGKPKRNSKGKILKAAPFQSSLAPVARIEPDRKWFGNTR 84 (572)
T ss_pred ccccccccCCccccCCccccccccccccccHHHHHHHHHHhccCcccccCCccccccccccccCcccccCCCchhccCce
Confidence 566777888999999999986 8999999999999999995 9999999999997 89999999999999999999999
Q ss_pred eechHHHHHHHHHHHhhhcCCcEEEecCCCcccccccchhhhhhhccccccccccccCCCCCCCCCCCCcCCHHHHHHHH
Q 018454 81 CVNQKQLEFFREELQSHMSSSYNVILREKKLPFSLLNDHQKQARVHLLDTEPFQDAFGPKGKRKRPKLLASDYESLVKRA 160 (355)
Q Consensus 81 vi~q~~l~~f~~~~~~~~~~p~~v~~~~~klp~~l~~~~~~~~~~~~~~~~~f~~~fg~~~qrkrp~l~~~~~~~l~~~~ 160 (355)
||+|++||+||++|+++++|||+||||++|||||||+|..+..++|+||+|||++|||+|+|||||+|.++++|+|.+.+
T Consensus 85 vI~q~~Lq~Fr~e~g~~~~dpyqVllk~~KlPmSLL~e~~k~~rvhvldtesF~~tFG~KsqRKRp~L~~s~le~L~k~a 164 (572)
T KOG2423|consen 85 VISQTELQKFREELGKKLKDPYQVLLKQSKLPMSLLQEKTKTPRVHVLDTESFEDTFGPKSQRKRPKLTASSLEELSKAA 164 (572)
T ss_pred eecHHHHHHHHHHHHhhhcChhhheeecCCCChhhhhccccCcceeeecccchhhhhCchhhhcCcccchhhHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhHHHHhhhcccCCcccccCCcchhhhhhhhccccchHHHHHHHHHhhhcCCCEEEEEecCCCCCCCcchHHHHHHHhh
Q 018454 161 DGSQDAFEQKNDASTSAEGVEGDGFRDLVRHTMFEKGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEH 240 (355)
Q Consensus 161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~s~ri~~el~kvi~~sDvVL~VvDardp~~s~~~~l~~~L~~~ 240 (355)
+..+..|+.+...+. ..+++|+....++++|.+|||+|+|.++|++|+++||||+|+|||||+|++|.++++||+++
T Consensus 165 ~e~~~~yee~~~~~~---~~e~~g~~~~~~~~if~kGQSkRIW~ELyKViDSSDVvvqVlDARDPmGTrc~~ve~ylkke 241 (572)
T KOG2423|consen 165 EESDDKYEEKKLGDL---REEEDGVRKAARDAIFSKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRCKHVEEYLKKE 241 (572)
T ss_pred hhhhhhhhhhccccc---hhhcccchHHHHHHHHhccchhHHHHHHHHhhcccceeEEeeeccCCcccccHHHHHHHhhc
Confidence 999999998855443 45678899999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCcEEEEEeccCCCChhhHHHHHHHHhhhCCceEEEeeecCCCChHHHHHHHHHHHhhhccccceEEEEeecCCCChh
Q 018454 241 CKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNVGKS 320 (355)
Q Consensus 241 ~~~k~vILVlNK~DLvp~~~~~~w~~~l~~~~p~~~f~vSa~~~~Gi~~Ll~~L~q~~~~~~~~~~i~V~~vG~pNVGKS 320 (355)
.+|||+|+|+|||||+|.|++..|+..|++++|+++||+|..+.+|.+.|+++|+||..+|.++++|+||||||||||||
T Consensus 242 ~phKHli~vLNKvDLVPtwvt~~Wv~~lSkeyPTiAfHAsi~nsfGKgalI~llRQf~kLh~dkkqISVGfiGYPNvGKS 321 (572)
T KOG2423|consen 242 KPHKHLIYVLNKVDLVPTWVTAKWVRHLSKEYPTIAFHASINNSFGKGALIQLLRQFAKLHSDKKQISVGFIGYPNVGKS 321 (572)
T ss_pred CCcceeEEEeeccccccHHHHHHHHHHHhhhCcceeeehhhcCccchhHHHHHHHHHHhhccCccceeeeeecCCCCchH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhhccCccccCCCCCee-EEEEEEEeee
Q 018454 321 SVINTLRTKNVILFFPASVVW-YWFYCQLLFY 351 (355)
Q Consensus 321 SLIN~Ll~~~~~~vs~iPGtT-~~~y~~l~~~ 351 (355)
|+||+|+.+++|+|+||||+| +||||||++.
T Consensus 322 SiINTLR~KkVCkvAPIpGETKVWQYItLmkr 353 (572)
T KOG2423|consen 322 SIINTLRKKKVCKVAPIPGETKVWQYITLMKR 353 (572)
T ss_pred HHHHHHhhcccccccCCCCcchHHHHHHHHhc
Confidence 999999999999999999999 9999999874
|
|
| >PF08153 NGP1NT: NGP1NT (NUC091) domain; InterPro: IPR012971 This N-terminal domain is found in a subfamily of hypothetical nucleolar GTP-binding proteins similar to human NGP1 [] | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2484 consensus GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >KOG1249 consensus Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04165 GTPBP1_like GTPBP1-like | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PRK15467 ethanolamine utilization protein EutP; Provisional | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PTZ00099 rab6; Provisional | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >cd01873 RhoBTB RhoBTB subfamily | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >cd04133 Rop_like Rop subfamily | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >TIGR00437 feoB ferrous iron transporter FeoB | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >COG0536 Obg Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG2229 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >PRK00741 prfC peptide chain release factor 3; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1249 consensus Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) | Back alignment and domain information |
|---|
| >KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0395 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2486 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PLN00116 translation elongation factor EF-2 subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PTZ00416 elongation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >smart00053 DYNc Dynamin, GTPase | Back alignment and domain information |
|---|
| >KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >KOG0394 consensus Ras-related GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00023 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >COG0523 Putative GTPases (G3E family) [General function prediction only] | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
|---|
| >KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
|---|
| >PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
|---|
| >PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
|---|
| >KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 355 | ||||
| 1puj_A | 282 | Structure Of B. Subtilis Ylqf Gtpase Length = 282 | 1e-07 | ||
| 3cnl_A | 262 | Crystal Structure Of Gnp-Bound Ylqf From T. Maritim | 5e-06 |
| >pdb|1PUJ|A Chain A, Structure Of B. Subtilis Ylqf Gtpase Length = 282 | Back alignment and structure |
|
| >pdb|3CNL|A Chain A, Crystal Structure Of Gnp-Bound Ylqf From T. Maritima Length = 262 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 355 | |||
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 5e-42 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 2e-38 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 1e-27 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 1e-23 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-04 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 1e-05 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 2e-05 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 3e-05 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 3e-05 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 9e-05 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 2e-04 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 3e-04 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 8e-04 |
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 | Back alignment and structure |
|---|
Score = 146 bits (371), Expect = 5e-42
Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 19/134 (14%)
Query: 198 QSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVP 257
++KR +L ++++ VV+V DAR P T + ++ K I+LLNK D+
Sbjct: 10 KAKRQIKDLLRLVN---TVVEVRDARAPFATSAYGVD------FSRKETIILLNKVDIAD 60
Query: 258 AWATKGWLRVLSKEYPSLAFHASINKSFGKGSLLSVLRQFARLKSDKQAISVGFVGYPNV 317
TK W+ K+ + +K + LL +L D+ V VG PN
Sbjct: 61 EKTTKKWVEFFKKQGKRVIT---THKGEPRKVLL------KKLSFDR-LARVLIVGVPNT 110
Query: 318 GKSSVINTLRTKNV 331
GKS++IN L+ K
Sbjct: 111 GKSTIINKLKGKRA 124
|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 355 | |||
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 99.93 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 99.92 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 99.92 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 99.89 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 99.79 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 99.77 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 99.69 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 99.68 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 99.65 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 99.63 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 99.62 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 99.21 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 99.01 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 98.82 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 98.78 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 98.77 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 98.76 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 98.63 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 98.62 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 98.62 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 98.61 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 98.6 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 98.58 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 98.56 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 98.55 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 98.54 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 98.53 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 98.53 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 98.52 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 98.52 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 98.51 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 98.5 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 98.5 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 98.49 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 98.49 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 98.48 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 98.47 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 98.47 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 98.46 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 98.46 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 98.46 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 98.45 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 98.45 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 98.44 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 98.44 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 98.44 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 98.44 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 98.43 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 98.43 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 98.43 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 98.42 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 98.42 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 98.41 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 98.41 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 98.41 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 98.41 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 98.41 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 98.41 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 98.4 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 98.4 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 98.4 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 98.39 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 98.39 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 98.39 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 98.39 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 98.39 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 98.38 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 98.38 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 98.37 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 98.37 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 98.37 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 98.37 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 98.37 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 98.36 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 98.36 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 98.36 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 98.36 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 98.35 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 98.35 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 98.35 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 98.35 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 98.35 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 98.35 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 98.35 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 98.35 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 98.34 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 98.34 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 98.34 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 98.34 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 98.33 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 98.33 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 98.33 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 98.32 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 98.32 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 98.32 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 98.32 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 98.32 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 98.31 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 98.31 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 98.31 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 98.31 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 98.31 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 98.31 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 98.3 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 98.3 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 98.29 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 98.29 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 98.29 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 98.29 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 98.29 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 98.29 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 98.28 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 98.27 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 98.26 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 98.25 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 98.23 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 98.22 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 98.22 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 98.22 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 98.21 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 98.21 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 98.21 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 98.21 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 98.2 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 98.19 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 98.18 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 98.18 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 98.17 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 98.17 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 98.16 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 97.46 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 98.16 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 98.16 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 98.15 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 98.15 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 98.15 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 98.14 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 98.13 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 98.11 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 98.11 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 98.11 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 98.09 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 98.09 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 98.06 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 98.06 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 98.05 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 98.05 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 98.03 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 98.02 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 98.02 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 98.0 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 97.99 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 97.98 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 97.98 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 97.98 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 97.97 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 97.95 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 97.93 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 97.93 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 97.93 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 97.92 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 97.92 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 97.91 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 97.91 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 97.9 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 97.9 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 97.89 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 97.86 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 97.86 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 97.86 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 97.84 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.84 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 97.84 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 97.84 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 97.83 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 97.81 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 97.79 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 97.78 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 97.78 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 97.77 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 97.75 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 97.73 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 97.73 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 97.72 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 97.71 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 97.69 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.69 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 97.68 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 97.67 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 97.67 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 97.67 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 97.67 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 97.64 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 97.64 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 97.63 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 97.63 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.63 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 97.62 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 97.61 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 97.61 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 97.61 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 97.57 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.57 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 97.56 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 97.56 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 97.55 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.54 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 97.54 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 97.52 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 97.51 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 97.49 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 97.48 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 97.47 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 97.47 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 97.46 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 97.46 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 97.46 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 97.45 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 97.45 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 97.44 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 97.44 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 97.44 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 97.43 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 97.43 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 97.43 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 97.42 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 97.41 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 97.4 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 97.39 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 97.38 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 97.37 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 97.36 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 97.35 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 97.35 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 97.35 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 97.34 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 97.32 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 97.32 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 97.31 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 97.31 | |
| 3vqt_A | 548 | RF-3, peptide chain release factor 3; translation, | 97.31 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 97.3 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 97.3 | |
| 3l82_B | 227 | F-box only protein 4; TRFH domain, helix, GTPase d | 97.29 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 97.28 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 97.28 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 97.27 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 97.26 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 97.26 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 97.26 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 97.25 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 97.25 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 97.21 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 97.21 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 97.2 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 97.2 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 97.19 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 97.19 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.17 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 97.17 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 97.13 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 97.12 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 97.11 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 97.1 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 97.09 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 97.09 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 97.06 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 97.04 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 97.03 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 97.03 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 97.03 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 97.01 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 97.01 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 97.01 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 96.97 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 96.97 | |
| 1cip_A | 353 | Protein (guanine nucleotide-binding protein alpha- | 96.96 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 96.95 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 96.94 | |
| 3j25_A | 638 | Tetracycline resistance protein TETM; antibiotic r | 96.91 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 96.89 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 96.88 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 96.87 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 96.86 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.83 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.83 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 95.84 | |
| 1zcb_A | 362 | G alpha I/13; GTP-binding, lipoprotein, membrane, | 96.79 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 96.77 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 96.76 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 96.74 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 96.71 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 96.69 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.65 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 96.62 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.59 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 96.55 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 96.53 | |
| 1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.49 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.49 | |
| 4fn5_A | 709 | EF-G 1, elongation factor G 1; translation, transl | 96.48 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 96.47 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 96.47 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 96.45 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 96.44 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 96.44 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 96.42 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.42 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 96.37 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.33 | |
| 2xtz_A | 354 | Guanine nucleotide-binding protein alpha-1 subuni; | 96.32 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 96.3 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 96.28 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.27 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.26 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 96.23 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.13 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 96.1 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 96.05 | |
| 4fid_A | 340 | G protein alpha subunit; RAS-like domain, all-heli | 96.01 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 95.99 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.95 | |
| 1azs_C | 402 | GS-alpha; complex (lyase/hydrolase), hydrolase, si | 95.9 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 95.83 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 95.77 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 95.73 | |
| 3ohm_A | 327 | Guanine nucleotide-binding protein G(Q) subunit A; | 95.71 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 95.7 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 95.38 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.3 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.24 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 95.02 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 94.91 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.55 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 94.41 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 94.35 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 94.32 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 94.25 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 94.25 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 94.23 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.19 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 93.94 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 93.91 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 93.7 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 93.67 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 93.62 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 93.54 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 93.42 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 93.36 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 93.23 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 93.19 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 93.17 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 93.15 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 93.09 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 93.08 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 92.99 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 92.94 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 92.88 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 92.79 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 92.77 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 92.75 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 92.74 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 92.6 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 92.48 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 92.43 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 92.33 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 92.32 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 92.3 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 92.28 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 92.23 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 92.23 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 92.23 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 92.18 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 92.16 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.09 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 92.08 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 91.97 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 91.97 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 91.96 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 91.96 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 91.94 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 91.9 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 91.89 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 91.87 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.85 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 91.83 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 91.78 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 91.74 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 91.72 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 91.71 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 91.71 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 91.69 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.68 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.66 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 91.63 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 91.57 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 91.56 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 91.42 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 91.38 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 91.38 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 91.36 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 91.29 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 91.29 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 91.27 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 91.26 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 91.19 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 91.18 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 91.16 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 91.16 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 91.06 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 91.05 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 90.92 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 90.91 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 90.9 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 90.88 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 90.83 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 90.82 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 90.68 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.65 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 90.6 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 90.55 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 90.53 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.42 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 90.4 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 90.4 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 90.33 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 90.29 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 90.24 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 90.18 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.14 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 90.13 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 90.06 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 90.05 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 89.89 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 89.79 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 89.71 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 89.55 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 89.05 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 89.02 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 89.0 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 88.92 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 88.92 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 88.87 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 88.87 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 88.8 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 88.64 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 88.62 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 88.59 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 88.55 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 88.55 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 88.51 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 88.36 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 88.3 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 88.27 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 88.24 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 88.22 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 88.15 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 88.1 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 88.09 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 88.02 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 88.02 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 88.02 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 88.0 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 87.97 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 87.95 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 87.94 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 87.82 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 87.67 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 87.65 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 87.61 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 87.58 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 87.52 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 87.51 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 87.51 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 87.47 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 87.41 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 87.36 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 87.31 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 87.07 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 87.04 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 87.03 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 86.99 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 86.89 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 86.87 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 86.83 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 86.82 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 86.77 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 86.77 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 86.63 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 86.61 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 86.5 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 86.36 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 86.34 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 86.28 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 86.27 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 86.23 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 86.21 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 86.03 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 85.72 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 85.71 |
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
Probab=99.93 E-value=6.4e-26 Score=216.02 Aligned_cols=143 Identities=27% Similarity=0.326 Sum_probs=114.3
Q ss_pred cchHHHHHHHHHhhhcCCCEEEEEecCCCCCCCcchHHHHHHHhhcCCCcEEEEEeccCCCChhhHHHHHHHHhhhCCce
Q 018454 196 KGQSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSL 275 (355)
Q Consensus 196 ~~~s~ri~~el~kvi~~sDvVL~VvDardp~~s~~~~l~~~L~~~~~~k~vILVlNK~DLvp~~~~~~w~~~l~~~~p~~ 275 (355)
+||+.++++++.+.++.+|+||+|+||++|.++.++.+.+++ .++|.++|+||+||++....+.|.+++.... ..
T Consensus 7 PGhm~ka~~~~~~~l~~aDvVl~VvDAr~p~~~~~~~l~~~l----~~kp~ilVlNK~DL~~~~~~~~~~~~~~~~g-~~ 81 (282)
T 1puj_A 7 PGHMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDIL----KNKPRIMLLNKADKADAAVTQQWKEHFENQG-IR 81 (282)
T ss_dssp --CTTHHHHHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHC----SSSCEEEEEECGGGSCHHHHHHHHHHHHTTT-CC
T ss_pred chHHHHHHHHHHHHHhhCCEEEEEEeCCCCCccCCHHHHHHH----CCCCEEEEEECcccCCHHHHHHHHHHHHhcC-Cc
Confidence 678889999999999999999999999999999988888887 4799999999999999877889999986532 24
Q ss_pred EEEeeecCCCChHHHHHHHHHHHhhhc--------cccceEEEEeecCCCChhHHHHHhhccCccccCCCCCeeEE
Q 018454 276 AFHASINKSFGKGSLLSVLRQFARLKS--------DKQAISVGFVGYPNVGKSSVINTLRTKNVILFFPASVVWYW 343 (355)
Q Consensus 276 ~f~vSa~~~~Gi~~Ll~~L~q~~~~~~--------~~~~i~V~~vG~pNVGKSSLIN~Ll~~~~~~vs~iPGtT~~ 343 (355)
++.+|+.++.|+++|++.+.+++.... ...+++|++||+||||||||||+|.+...+.|+++||+|++
T Consensus 82 ~i~iSA~~~~gi~~L~~~i~~~l~~~~~~~~~~~~~~~~~~v~~vG~~nvGKSsliN~l~~~~~~~~~~~~g~T~~ 157 (282)
T 1puj_A 82 SLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTS 157 (282)
T ss_dssp EEECCTTTCTTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHHHHHHHHTSCCC-----------
T ss_pred EEEEECCCcccHHHHHHHHHHHHHHHHHHHHhcCCCCCCceEEEEecCCCchHHHHHHHhcCceeecCCCCCeeee
Confidence 667899999999999998888775321 24568999999999999999999999999999999999954
|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 355 | ||||
| d1puja_ | 273 | c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti | 3e-19 | |
| d1t9ha2 | 231 | c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C | 3e-06 | |
| d1mkya2 | 186 | c.37.1.8 (A:173-358) Probable GTPase Der, N-termin | 2e-05 | |
| d1xzpa2 | 160 | c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog | 3e-05 | |
| d2cxxa1 | 184 | c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc | 3e-05 | |
| d1tq4a_ | 400 | c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( | 3e-05 | |
| d1lnza2 | 185 | c.37.1.8 (A:158-342) Obg GTP-binding protein middl | 6e-05 | |
| d1udxa2 | 180 | c.37.1.8 (A:157-336) Obg GTP-binding protein middl | 7e-05 | |
| d1egaa1 | 179 | c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { | 2e-04 | |
| d1mkya1 | 171 | c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal | 2e-04 | |
| d1puia_ | 188 | c.37.1.8 (A:) Probable GTPase EngB {Escherichia co | 4e-04 | |
| d2gj8a1 | 161 | c.37.1.8 (A:216-376) Probable tRNA modification GT | 4e-04 | |
| d1wxqa1 | 319 | c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr | 0.001 | |
| d1wf3a1 | 178 | c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { | 0.001 | |
| d1u0la2 | 225 | c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C | 0.001 | |
| d1ni3a1 | 296 | c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter | 0.002 | |
| d1h65a_ | 257 | c.37.1.8 (A:) Chloroplast protein translocon GTPas | 0.002 | |
| d1jala1 | 278 | c.37.1.8 (A:1-278) YchF GTP-binding protein N-term | 0.003 | |
| d1fzqa_ | 176 | c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus | 0.004 |
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Probable GTPase YlqF species: Bacillus subtilis [TaxId: 1423]
Score = 84.1 bits (207), Expect = 3e-19
Identities = 39/134 (29%), Positives = 59/134 (44%), Gaps = 11/134 (8%)
Query: 205 ELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGW 264
E+ + + D+V +++DAR P +R +E L K+K I+LLNK D A T+ W
Sbjct: 8 EVTEKLKLIDIVYELVDARIPMSSRNPMIEDIL----KNKPRIMLLNKADKADAAVTQQW 63
Query: 265 LRVLSKEYPSLAFHASINKS-------FGKGSLLSVLRQFARLKSDKQAISVGFVGYPNV 317
+ S+N K L + +AI +G PNV
Sbjct: 64 KEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNV 123
Query: 318 GKSSVINTLRTKNV 331
GKS++IN L KN+
Sbjct: 124 GKSTLINRLAKKNI 137
|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 355 | |||
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 99.95 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 99.7 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 99.66 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 99.14 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 98.99 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 98.95 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 98.94 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 98.74 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 98.67 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 98.66 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 98.65 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 98.63 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 98.62 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 98.6 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 98.53 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 98.47 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 98.45 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 98.42 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 98.35 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 98.35 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 98.32 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 98.28 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 98.27 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 98.25 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 98.25 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 98.25 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 98.19 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 98.19 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 98.18 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 98.15 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 98.15 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.14 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 98.12 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 98.11 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.1 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 98.09 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 98.04 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 98.04 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 98.02 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 98.02 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 98.02 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 98.01 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.01 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.01 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 98.0 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 98.0 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 97.99 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 97.97 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 97.95 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 97.95 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 97.94 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 97.92 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 97.92 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 97.91 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 97.9 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 97.89 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 97.89 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 97.87 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 97.84 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 97.82 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 97.8 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 97.79 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 97.77 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 97.76 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 97.75 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 97.74 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 97.72 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 97.71 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 97.64 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 97.62 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 97.6 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.59 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 97.53 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 97.44 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.36 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 97.32 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 97.19 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 97.18 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 97.16 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 97.11 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.99 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 96.94 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 96.87 | |
| d1f60a3 | 239 | Elongation factor eEF-1alpha, N-terminal (G) domai | 96.52 | |
| d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 96.47 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.22 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.17 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.13 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 95.7 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 95.66 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 95.57 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 95.4 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 95.2 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.04 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 94.91 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 94.61 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 94.44 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 94.14 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 94.07 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 94.01 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 93.91 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.76 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 93.64 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.6 | |
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 93.52 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 93.39 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 93.32 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.94 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 92.86 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 92.85 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 92.75 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 92.68 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 92.68 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 92.32 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 92.3 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 92.28 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.21 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.19 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 92.14 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 92.04 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 92.02 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 91.97 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 91.95 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 91.92 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 91.72 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 91.61 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.57 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 91.56 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 91.47 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 91.4 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 91.37 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 90.89 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 90.78 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 90.39 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 89.59 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 89.55 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 89.45 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 89.34 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 89.21 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 88.32 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 88.18 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 88.0 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 87.34 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 87.33 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 86.79 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 86.44 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 86.4 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 85.5 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 85.34 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 85.19 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 84.27 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 84.04 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 83.81 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 82.43 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 82.09 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 81.53 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 81.46 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 81.26 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 81.22 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 80.6 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 80.21 |
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Probable GTPase YlqF species: Bacillus subtilis [TaxId: 1423]
Probab=99.95 E-value=9.9e-29 Score=231.70 Aligned_cols=141 Identities=26% Similarity=0.319 Sum_probs=113.1
Q ss_pred hHHHHHHHHHhhhcCCCEEEEEecCCCCCCCcchHHHHHHHhhcCCCcEEEEEeccCCCChhhHHHHHHHHhhhCCceEE
Q 018454 198 QSKRIWGELYKVIDSSDVVVQVLDARDPQGTRCHHLERHLKEHCKHKHMILLLNKCDLVPAWATKGWLRVLSKEYPSLAF 277 (355)
Q Consensus 198 ~s~ri~~el~kvi~~sDvVL~VvDardp~~s~~~~l~~~L~~~~~~k~vILVlNK~DLvp~~~~~~w~~~l~~~~p~~~f 277 (355)
|+.+..+++.+.++.+|+||+|+|||+|.+++++.++++++ +||.|+|+||+||++.+....|.++|...+. ..+
T Consensus 1 Hm~ka~r~i~~~i~~~DvIl~V~DaR~P~ss~~~~l~~~~~----~Kp~IlVlNK~DLv~~~~~~~w~~~f~~~~~-~~i 75 (273)
T d1puja_ 1 HMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILK----NKPRIMLLNKADKADAAVTQQWKEHFENQGI-RSL 75 (273)
T ss_dssp CTTHHHHHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHCS----SSCEEEEEECGGGSCHHHHHHHHHHHHTTTC-CEE
T ss_pred CHHHHHHHHHHHHHhCCEEEEEEECCCCCCCCCHHHHHHHc----CCCeEEEEECccCCchHHHHHHHHHHHhcCC-ccc
Confidence 45678899999999999999999999999999999998874 7999999999999999999999999987643 356
Q ss_pred EeeecCCCChHHHHHHHHHHHhhh--------ccccceEEEEeecCCCChhHHHHHhhccCccccCCCCCeeEE
Q 018454 278 HASINKSFGKGSLLSVLRQFARLK--------SDKQAISVGFVGYPNVGKSSVINTLRTKNVILFFPASVVWYW 343 (355)
Q Consensus 278 ~vSa~~~~Gi~~Ll~~L~q~~~~~--------~~~~~i~V~~vG~pNVGKSSLIN~Ll~~~~~~vs~iPGtT~~ 343 (355)
.+|+.++.|...+...+.+++... .....++|++||+||||||||||+|++++++.|++.||+|++
T Consensus 76 ~isa~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~vvG~PNvGKSsliN~L~~~~~~~~~~~pG~Tr~ 149 (273)
T d1puja_ 76 SINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTS 149 (273)
T ss_dssp ECCTTTCTTGGGHHHHHHHHHHHHHHHHHHTTCCCCCEEEEEEESTTSSHHHHHHHHHTSCCC-----------
T ss_pred eeecccCCCccccchhhhhhhhhhhhhhhhccCCCCceEEEEEecCccchhhhhhhhhccceEEECCccccccc
Confidence 689999999988877666555432 234679999999999999999999999999999999999954
|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|