Citrus Sinensis ID: 018467


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MKEKISAATEEVKGTFRTGSTDTSAKHDDDVRDGFKASSGEEKQKQTVSSDTAETFYGKLKSSISSPKFTLAFQKLKEAKVVDLAKKGYDIVKDELSGSPSKRKHLEYTPSPSWTGEKSTRTDLVVTPSKKSMWSKLKEKMQGYPVFKRITGISEPVVTKGQEIAEDVRERWETSDNPIVHKIQDMNETIFQETDAAASIKEIRRRDPSFSLPDFVSEVQEAIRPVLSAYMKGDVETLKKYCSPEVIERCKAEHTAYQSHGIFFDNRILHVSEVEVRETKMMGSSPIIIVAFQTQQIYCVRDKHGTITEGGKDTIQTVYYAWAMQQVDAEELGEDVLYPIWKLREMQQLGVQALI
ccHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccCEEEcccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHcccCECcEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEcccccEEccccccEEEEEEEEEEEEEcccccccccccccEEEEHHHHccccccc
*****S*********************************************************************LKEAKVVDLAKKGYDIV************************************************MQGYPVFKRITGISEPVVTKGQEIAEDVRERWET*DNPIVHKIQDMNETIFQETDAAASIKEIRRRDPSFSLPDFVSEVQEAIRPVLSAYMKGDVETLKKYCSPEVIERCKAEHTAYQSHGIFFDNRILHVSEVEVRETKMMGSSPIIIVAFQTQQIYCVRDKHGTITEGGKDTIQTVYYAWAMQQVDAEELGEDVLYPIWKLREMQQLG*QA*I
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKEKISAATEEVKGTFRTGSTDTSAKHDDDVRDGFKASSGEEKQKQTVSSDTAETFYGKLKSSISSPKFTLAFQKLKEAKVVDLAKKGYDIVKDELSGSPSKRKHLEYTPSPSWTGEKSTRTDLVVTPSKKSMWSKLKEKMQGYPVFKRITGISEPVVTKGQEIAEDVRERWETSDNPIVHKIQDMNETIFQETDAAASIKEIRRRDPSFSLPDFVSEVQEAIRPVLSAYMKGDVETLKKYCSPEVIERCKAEHTAYQSHGIFFDNRILHVSEVEVRETKMMGSSPIIIVAFQTQQIYCVRDKHGTITEGGKDTIQTVYYAWAMQQVDAEELGEDVLYPIWKLREMQQLGVQALI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import inner membrane translocase subunit TIM44-2 Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source.probableQ5XF06

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QK9, chain A
Confidence level:very confident
Coverage over the Query: 151,167-354
View the alignment between query and template
View the model in PyMOL