Citrus Sinensis ID: 018471


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----
MGSGETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERIRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHHHHHHHHHHHcccccccccHHcccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEcccccc
**********PAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERIRYNAA***********************AVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSI*****************************************************GVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSGETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERIRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYHSDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxisome biogenesis factor 10 Involved in the formation of peroxisomes, lipid bodies and protein bodies. Required for normal-shaped peroxisomes that can physically associate with the outer membrane of the chloroplast envelope. Not involved in beta-oxidation and glyoxylate cycle.confidentQ9SYU4
Peroxisome biogenesis factor 10 Somewhat implicated in the biogenesis of peroxisomes.probableO60683
Peroxisome biogenesis factor 10 Somewhat implicated in the biogenesis of peroxisomes.probableB1AUE5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP4, chain A
Confidence level:very confident
Coverage over the Query: 296-352
View the alignment between query and template
View the model in PyMOL
Template: 2Y1N, chain A
Confidence level:confident
Coverage over the Query: 188-350
View the alignment between query and template
View the model in PyMOL