Citrus Sinensis ID: 018471
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 355 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SYU4 | 381 | Peroxisome biogenesis fac | yes | no | 0.977 | 0.910 | 0.710 | 1e-146 | |
| Q8HXW8 | 326 | Peroxisome biogenesis fac | N/A | no | 0.856 | 0.932 | 0.314 | 9e-39 | |
| O60683 | 326 | Peroxisome biogenesis fac | yes | no | 0.856 | 0.932 | 0.314 | 2e-37 | |
| Q54S31 | 374 | Peroxisome biogenesis fac | yes | no | 0.805 | 0.764 | 0.313 | 3e-37 | |
| B1AUE5 | 324 | Peroxisome biogenesis fac | yes | no | 0.861 | 0.944 | 0.310 | 3e-35 | |
| Q05568 | 337 | Peroxisome biogenesis fac | yes | no | 0.788 | 0.830 | 0.307 | 1e-34 | |
| Q00940 | 295 | Peroxisome biogenesis fac | N/A | no | 0.788 | 0.949 | 0.295 | 6e-33 | |
| Q92265 | 419 | Peroxisome biogenesis fac | yes | no | 0.814 | 0.689 | 0.273 | 7e-22 | |
| Q9UUF0 | 306 | Peroxisome biogenesis fac | yes | no | 0.152 | 0.176 | 0.5 | 6e-10 | |
| Q91YT2 | 192 | E3 ubiquitin-protein liga | no | no | 0.214 | 0.395 | 0.341 | 7e-09 |
| >sp|Q9SYU4|PEX10_ARATH Peroxisome biogenesis factor 10 OS=Arabidopsis thaliana GN=PEX10 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 519 bits (1336), Expect = e-146, Method: Compositional matrix adjust.
Identities = 260/366 (71%), Positives = 284/366 (77%), Gaps = 19/366 (5%)
Query: 4 GETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLY 63
G RRFP AAQPEIMRAAEKD+QYASFI++ACRDAFR LFGTR+A+AYQ E KL+GQMLY
Sbjct: 21 GGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIALAYQKEMKLLGQMLY 80
Query: 64 YVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERIRYNAA--- 120
YVLTTGSGQQTLGEEYCDI QV GP L PTPARRALFI+YQTAVPYIAERI AA
Sbjct: 81 YVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFILYQTAVPYIAERISTRAATQA 140
Query: 121 ----------GSSRDQSLETIESPSSSAPRV-YSAVSRLKEKLNGLRLYVIRRWPMVLPI 169
G S S I+ PSSS S VSRL ++L I+RWP+VLP+
Sbjct: 141 VTFDESDEFFGDSHIHSPRMIDLPSSSQVETSTSVVSRLNDRLMRSWHRAIQRWPVVLPV 200
Query: 170 VREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCI 229
RE LQLVLRANLM FYFEG YYHISKR +G+RYVFIGK NQRPRYQILGVFLLIQLCI
Sbjct: 201 AREVLQLVLRANLMLFYFEGFYYHISKRASGVRYVFIGKQLNQRPRYQILGVFLLIQLCI 260
Query: 230 IAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTST 289
+AAEGLRRSNLSSI SS+ S+G Q S GRGLPVLNEEG+LI SE++KG W ST
Sbjct: 261 LAAEGLRRSNLSSITSSIQQASIGSYQTSGGRGLPVLNEEGNLITSEAEKGNW-----ST 315
Query: 290 SESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVC 349
S+S + V KCTLCLS RQ PTATPCGHVFCW+CIMEWCNEK ECPLCR P THSSLVC
Sbjct: 316 SDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCNEKQECPLCRTPNTHSSLVC 375
Query: 350 LYHSDF 355
LYHSDF
Sbjct: 376 LYHSDF 381
|
Involved in the formation of peroxisomes, lipid bodies and protein bodies. Required for normal-shaped peroxisomes that can physically associate with the outer membrane of the chloroplast envelope. Not involved in beta-oxidation and glyoxylate cycle. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q8HXW8|PEX10_MACFA Peroxisome biogenesis factor 10 OS=Macaca fascicularis GN=PEX10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O60683|PEX10_HUMAN Peroxisome biogenesis factor 10 OS=Homo sapiens GN=PEX10 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54S31|PEX10_DICDI Peroxisome biogenesis factor 10 OS=Dictyostelium discoideum GN=pex10 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|B1AUE5|PEX10_MOUSE Peroxisome biogenesis factor 10 OS=Mus musculus GN=Pex10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q05568|PEX10_YEAST Peroxisome biogenesis factor 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX10 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q00940|PEX10_PICAN Peroxisome biogenesis factor 10 OS=Pichia angusta GN=PEX10 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q92265|PEX10_PICPA Peroxisome biogenesis factor 10 OS=Komagataella pastoris GN=PEX10 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UUF0|PEX10_SCHPO Peroxisome biogenesis factor 10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pas4 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 355 | ||||||
| 359476271 | 400 | PREDICTED: peroxisome biogenesis factor | 0.980 | 0.87 | 0.754 | 1e-155 | |
| 224088762 | 357 | predicted protein [Populus trichocarpa] | 0.946 | 0.941 | 0.754 | 1e-149 | |
| 356552390 | 394 | PREDICTED: peroxisome biogenesis factor | 0.980 | 0.883 | 0.708 | 1e-145 | |
| 18401101 | 381 | peroxin 10 [Arabidopsis thaliana] gi|340 | 0.977 | 0.910 | 0.710 | 1e-145 | |
| 297825791 | 388 | hypothetical protein ARALYDRAFT_481492 [ | 0.977 | 0.894 | 0.705 | 1e-144 | |
| 449447165 | 397 | PREDICTED: peroxisome biogenesis factor | 0.980 | 0.876 | 0.720 | 1e-144 | |
| 7576235 | 381 | Pex10p [Arabidopsis thaliana] | 0.977 | 0.910 | 0.707 | 1e-144 | |
| 356564027 | 394 | PREDICTED: peroxisome biogenesis factor | 0.991 | 0.893 | 0.703 | 1e-143 | |
| 21592718 | 381 | putative peroxisome assembly protein PER | 0.977 | 0.910 | 0.702 | 1e-143 | |
| 171988284 | 397 | peroxisome biogenesis factor 10 [Nicotia | 0.991 | 0.886 | 0.711 | 1e-138 |
| >gi|359476271|ref|XP_002279784.2| PREDICTED: peroxisome biogenesis factor 10-like [Vitis vinifera] gi|296081704|emb|CBI20709.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 553 bits (1424), Expect = e-155, Method: Compositional matrix adjust.
Identities = 280/371 (75%), Positives = 303/371 (81%), Gaps = 23/371 (6%)
Query: 6 TRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYV 65
+RRFP AAQPEIMRAAEKD+QYAS +Y+ACRDAFR LFGTRVAVAYQSETKL+GQMLYY+
Sbjct: 32 SRRFPLAAQPEIMRAAEKDDQYASHVYEACRDAFRHLFGTRVAVAYQSETKLLGQMLYYI 91
Query: 66 LTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERIR--------- 116
LTTGSGQQTLGEEYCDITQV GP L PTPARRALFI+YQTAVPYIAER+
Sbjct: 92 LTTGSGQQTLGEEYCDITQVAGPYGLSPTPARRALFILYQTAVPYIAERVSSRVAARGIA 151
Query: 117 -----------YNAAGSSRDQSLETIESPSSSAPRVYSAV-SRLKEKLNGLRLYVIRRWP 164
N GSS+ QS E PSSSA +V SRLKEK N LY ++RWP
Sbjct: 152 IADAQADELYGNNVPGSSQVQSSAITEIPSSSASGASLSVLSRLKEKFNQSWLYAVQRWP 211
Query: 165 MVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLL 224
+VLP+ REFLQLVLR NLMFFYFEGLYYHISKR AGIRYVFIGK NQRPRYQILGVFLL
Sbjct: 212 VVLPLAREFLQLVLRTNLMFFYFEGLYYHISKRAAGIRYVFIGKSLNQRPRYQILGVFLL 271
Query: 225 IQLCIIAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVL 284
IQLCIIAAEGLRR NLSSIASSVH T LG Q +TG+GLPVLNEEG+LI +++DKG WV
Sbjct: 272 IQLCIIAAEGLRRRNLSSIASSVHRTPLGAHQTATGQGLPVLNEEGNLIAADADKGSWVS 331
Query: 285 DSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITH 344
DST ESQA+ GVSKCTLCLSNRQ PTATPCGHVFCW+CIMEWCNEKPECPLCR P+TH
Sbjct: 332 DSTYV-ESQAS-GVSKCTLCLSNRQHPTATPCGHVFCWSCIMEWCNEKPECPLCRTPLTH 389
Query: 345 SSLVCLYHSDF 355
SSLVCLYHSDF
Sbjct: 390 SSLVCLYHSDF 400
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224088762|ref|XP_002308529.1| predicted protein [Populus trichocarpa] gi|222854505|gb|EEE92052.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356552390|ref|XP_003544551.1| PREDICTED: peroxisome biogenesis factor 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18401101|ref|NP_565621.1| peroxin 10 [Arabidopsis thaliana] gi|34098752|sp|Q9SYU4.1|PEX10_ARATH RecName: Full=Peroxisome biogenesis factor 10; AltName: Full=PER10; AltName: Full=Peroxin-10; AltName: Full=Peroxisomal biogenesis factor 10; Short=AtPEX10; Short=AthPEX10; AltName: Full=Peroxisome assembly protein 10; AltName: Full=Pex10p gi|4337011|gb|AAD18035.1| zinc-binding peroxisomal integral membrane protein [Arabidopsis thaliana] gi|20196940|gb|AAC14514.2| putative peroxisome assembly protein PER8 [Arabidopsis thaliana] gi|26450822|dbj|BAC42519.1| putative zinc-binding peroxisomal integral membrane protein PEX10 [Arabidopsis thaliana] gi|28950961|gb|AAO63404.1| At2g26350 [Arabidopsis thaliana] gi|330252734|gb|AEC07828.1| peroxin 10 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297825791|ref|XP_002880778.1| hypothetical protein ARALYDRAFT_481492 [Arabidopsis lyrata subsp. lyrata] gi|297326617|gb|EFH57037.1| hypothetical protein ARALYDRAFT_481492 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449447165|ref|XP_004141339.1| PREDICTED: peroxisome biogenesis factor 10-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|7576235|emb|CAB87983.1| Pex10p [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356564027|ref|XP_003550258.1| PREDICTED: peroxisome biogenesis factor 10-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|21592718|gb|AAM64667.1| putative peroxisome assembly protein PER8 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|171988284|gb|ACB59354.1| peroxisome biogenesis factor 10 [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 355 | ||||||
| TAIR|locus:2057780 | 381 | PEX10 "peroxin 10" [Arabidopsi | 0.977 | 0.910 | 0.710 | 6.2e-133 | |
| ZFIN|ZDB-GENE-041010-71 | 318 | pex10 "peroxisome biogenesis f | 0.594 | 0.663 | 0.324 | 1.4e-46 | |
| DICTYBASE|DDB_G0282693 | 374 | pex10 "peroxisome biogenesis f | 0.523 | 0.497 | 0.345 | 2.9e-44 | |
| UNIPROTKB|E1BST1 | 327 | PEX10 "Uncharacterized protein | 0.608 | 0.660 | 0.314 | 4.1e-43 | |
| UNIPROTKB|I3LSN3 | 326 | LOC100736805 "Uncharacterized | 0.619 | 0.674 | 0.308 | 6.7e-43 | |
| UNIPROTKB|I3L768 | 326 | LOC100624129 "Uncharacterized | 0.619 | 0.674 | 0.308 | 1.1e-42 | |
| UNIPROTKB|O60683 | 326 | PEX10 "Peroxisome biogenesis f | 0.616 | 0.671 | 0.296 | 4.1e-41 | |
| UNIPROTKB|Q8HXW8 | 326 | PEX10 "Peroxisome biogenesis f | 0.633 | 0.690 | 0.306 | 4.1e-41 | |
| MGI|MGI:2684988 | 324 | Pex10 "peroxisomal biogenesis | 0.628 | 0.688 | 0.297 | 4.1e-41 | |
| RGD|1591776 | 324 | Pex10 "peroxisomal biogenesis | 0.614 | 0.672 | 0.288 | 2.2e-40 |
| TAIR|locus:2057780 PEX10 "peroxin 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1303 (463.7 bits), Expect = 6.2e-133, P = 6.2e-133
Identities = 260/366 (71%), Positives = 284/366 (77%)
Query: 4 GETRRFPPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLY 63
G RRFP AAQPEIMRAAEKD+QYASFI++ACRDAFR LFGTR+A+AYQ E KL+GQMLY
Sbjct: 21 GGIRRFPLAAQPEIMRAAEKDDQYASFIHEACRDAFRHLFGTRIALAYQKEMKLLGQMLY 80
Query: 64 YVLTTGSGQQTLGEEYCDITQVVGPQRLPPTPARRALFIVYQTAVPYIAERIRYNAA--- 120
YVLTTGSGQQTLGEEYCDI QV GP L PTPARRALFI+YQTAVPYIAERI AA
Sbjct: 81 YVLTTGSGQQTLGEEYCDIIQVAGPYGLSPTPARRALFILYQTAVPYIAERISTRAATQA 140
Query: 121 ----------GSSRDQSLETIESPSSSAPRVY-SAVSRLKEKLNGLRLYVIRRWPMVLPI 169
G S S I+ PSSS S VSRL ++L I+RWP+VLP+
Sbjct: 141 VTFDESDEFFGDSHIHSPRMIDLPSSSQVETSTSVVSRLNDRLMRSWHRAIQRWPVVLPV 200
Query: 170 VREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKPTNQRPRYQILGVFLLIQLCI 229
RE LQLVLRANLM FYFEG YYHISKR +G+RYVFIGK NQRPRYQILGVFLLIQLCI
Sbjct: 201 AREVLQLVLRANLMLFYFEGFYYHISKRASGVRYVFIGKQLNQRPRYQILGVFLLIQLCI 260
Query: 230 IAAEGLRRSNLSSIASSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTST 289
+AAEGLRRSNLSSI SS+ S+G Q S GRGLPVLNEEG+LI SE++KG W ST
Sbjct: 261 LAAEGLRRSNLSSITSSIQQASIGSYQTSGGRGLPVLNEEGNLITSEAEKGNW-----ST 315
Query: 290 SESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVC 349
S+S + V KCTLCLS RQ PTATPCGHVFCW+CIMEWCNEK ECPLCR P THSSLVC
Sbjct: 316 SDSTSTEAVGKCTLCLSTRQHPTATPCGHVFCWSCIMEWCNEKQECPLCRTPNTHSSLVC 375
Query: 350 LYHSDF 355
LYHSDF
Sbjct: 376 LYHSDF 381
|
|
| ZFIN|ZDB-GENE-041010-71 pex10 "peroxisome biogenesis factor 10" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0282693 pex10 "peroxisome biogenesis factor 10" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BST1 PEX10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LSN3 LOC100736805 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L768 LOC100624129 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60683 PEX10 "Peroxisome biogenesis factor 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8HXW8 PEX10 "Peroxisome biogenesis factor 10" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2684988 Pex10 "peroxisomal biogenesis factor 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1591776 Pex10 "peroxisomal biogenesis factor 10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O60683 | PEX10_HUMAN | No assigned EC number | 0.3146 | 0.8563 | 0.9325 | yes | no |
| B1AUE5 | PEX10_MOUSE | No assigned EC number | 0.3107 | 0.8619 | 0.9444 | yes | no |
| Q9SYU4 | PEX10_ARATH | No assigned EC number | 0.7103 | 0.9774 | 0.9107 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 355 | |||
| pfam04757 | 215 | pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal | 2e-40 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-13 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-12 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 2e-12 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 2e-12 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 5e-10 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-09 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 1e-08 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 3e-07 | |
| COG5432 | 391 | COG5432, RAD18, RING-finger-containing E3 ubiquiti | 4e-07 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 7e-07 | |
| COG5152 | 259 | COG5152, COG5152, Uncharacterized conserved protei | 1e-06 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 7e-06 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 4e-05 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 1e-04 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 2e-04 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 8e-04 |
| >gnl|CDD|218247 pfam04757, Pex2_Pex12, Pex2 / Pex12 amino terminal region | Back alignment and domain information |
|---|
Score = 141 bits (358), Expect = 2e-40
Identities = 62/208 (29%), Positives = 94/208 (45%), Gaps = 21/208 (10%)
Query: 24 DEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDIT 83
DE+ S + R R L G R + Y E KL+ ++LY LT G TLGEE+ +
Sbjct: 1 DEELESLLRPQLRYILRYLAGARFLLNYFDELKLLLKLLYERLTLLRGNATLGEEFYGLK 60
Query: 84 QV-VGPQRLPPTPARRALFIVYQTAVPYIAERIRYNAAGSSRDQSLETIESPSSSAPRVY 142
+V + + +R L ++ PY+ ++ ++ LE S
Sbjct: 61 RVNEDDEGRLLSRKQRLLSLLLLVLGPYLLRKLDS-LLERLLEEDLENSLLRQSRL---- 115
Query: 143 SAVSRLKEKLNGLRLYVIRRWPMVLPIVREFLQLVLRANLMFFYFEGLYYHISKRTAGIR 202
SRLK +L L+LY P + L+L+ + + F F G YY +SKR GIR
Sbjct: 116 ---SRLKRRL--LKLY---------PALNALLELLNLLHFLLFLFGGTYYSLSKRLLGIR 161
Query: 203 YVFIGKPTNQR-PRYQILGVFLLIQLCI 229
YV + + +R Y+ LG LL QL +
Sbjct: 162 YVRLNQSDLERNVSYEFLGRLLLWQLFV 189
|
This region is found at the N terminal of a number of known and predicted peroxins including Pex2, Pex10 and Pex12. This conserved region is usually associated with a C terminal ring finger (pfam00097) domain. Length = 215 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 355 | |||
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 100.0 | |
| PF04757 | 229 | Pex2_Pex12: Pex2 / Pex12 amino terminal region; In | 99.97 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.94 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 99.63 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 99.58 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.44 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.38 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.2 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.12 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.97 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.94 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.94 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.91 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.9 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.88 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.84 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.81 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.71 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.7 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.69 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.68 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.66 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.64 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.56 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.49 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.46 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.45 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.43 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.35 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.26 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.16 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.15 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.12 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.11 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.06 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.05 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.97 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.87 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.85 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 97.79 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.78 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.74 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 97.67 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.56 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 97.51 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.46 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.43 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 97.42 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 97.4 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.39 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.34 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 97.16 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 97.11 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 97.03 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.02 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.88 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.86 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 96.85 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.76 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 96.74 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 96.57 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 96.56 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.47 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.43 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 96.14 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.05 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 95.99 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.47 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 95.43 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 95.37 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 95.31 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 94.81 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.7 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 94.24 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.87 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 93.66 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.34 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 93.09 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 92.88 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.73 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 92.64 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 92.29 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 90.67 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 90.61 | |
| PHA03096 | 284 | p28-like protein; Provisional | 90.43 | |
| KOG3113 | 293 | consensus Uncharacterized conserved protein [Funct | 90.13 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 89.68 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 89.38 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 89.14 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 88.93 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.52 | |
| KOG3579 | 352 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.03 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 87.7 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 87.1 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 86.93 | |
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 86.81 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 86.74 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 86.3 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 85.7 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 85.21 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 84.23 | |
| KOG3899 | 381 | consensus Uncharacterized conserved protein [Funct | 83.7 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 83.48 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 83.33 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 83.1 | |
| PHA02862 | 156 | 5L protein; Provisional | 82.59 | |
| KOG3842 | 429 | consensus Adaptor protein Pellino [Signal transduc | 81.97 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 81.93 |
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.1e-56 Score=396.86 Aligned_cols=284 Identities=35% Similarity=0.654 Sum_probs=224.7
Q ss_pred CCCCCchhhhhhhhhHHHHHHHHHHHHHHHHHhcchhHHHhcHHHHHHHHHHHHHHhhhcCCCCcccccccceEEecCCC
Q 018471 10 PPAAQPEIMRAAEKDEQYASFIYDACRDAFRQLFGTRVAVAYQSETKLVGQMLYYVLTTGSGQQTLGEEYCDITQVVGPQ 89 (355)
Q Consensus 10 p~A~~p~Ilra~QkD~~~~~~L~~~l~~~~~~~~g~r~~~~~~~ei~~~~~lly~~lTt~~g~qTlGeEy~~l~~v~~~~ 89 (355)
+.|++|+|+|+.||||+|.+.+..+++++.+.+.|+|.|++|++|+..+++.+||.+||..+.||+||||++|+++|+.+
T Consensus 5 ~~a~~p~ivr~tq~de~~~~~l~~~~s~~~~~lag~r~~i~~~~~l~~~a~~ly~~~at~~~~~tlgEEy~~i~~~~~~~ 84 (293)
T KOG0317|consen 5 AHADPPEIVRSTQKDEYYIGYLISSLSGLSRTLAGPRAWIRYRKELVLIAEVLYFGFATDARYQTLGEEYVSIIESNPLR 84 (293)
T ss_pred cccCchHHHHHhhhHHHhhhhhhhhhHhHhhhhcchHHHHhhccchhhhhchhhheeehhccccccchhhhhhheecCCc
Confidence 88999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCchhHHHHHHHHHhhHHHHHHHHHHHhhcccccccccccCCCCCCCcchhhhHHHHHHHhhhhHHHHHhhcCcchhH
Q 018471 90 RLPPTPARRALFIVYQTAVPYIAERIRYNAAGSSRDQSLETIESPSSSAPRVYSAVSRLKEKLNGLRLYVIRRWPMVLPI 169 (355)
Q Consensus 90 ~~~ps~~rr~~~vll~~~~pyl~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 169 (355)
..+|+..+|..+++++.+.||+..++.+.+....+.. ++ -.| ..+ .++
T Consensus 85 ~~~pssl~~~~~v~~~~v~~~~~~~l~~~l~q~l~~~-------~~-i~p-------~~~-----------------~~~ 132 (293)
T KOG0317|consen 85 LRLPSSLRRIVFVASHLVLPLLLDKLTKKLMQALQSS-------SE-ILP-------QAR-----------------RNF 132 (293)
T ss_pred cccCchhhhHHHHHHHHHHHHHhHHHHHHHHHhhccC-------cc-ccc-------HHH-----------------HHH
Confidence 9999999999999999999999999998877543211 00 000 000 111
Q ss_pred HHHHHHHHHHhhHHHhhcccccchhhhhhcCceEEEecCC----CCCCchhHHHHHHHHHHHHHHHhhhhh-hccccccc
Q 018471 170 VREFLQLVLRANLMFFYFEGLYYHISKRTAGIRYVFIGKP----TNQRPRYQILGVFLLIQLCIIAAEGLR-RSNLSSIA 244 (355)
Q Consensus 170 ~~~~~~~~~~lhl~~Fy~~G~Yy~l~kRi~giryv~~~~~----~~~~~sy~~LG~lll~ql~~~~~~~~r-~~~~~~~~ 244 (355)
+++.+ .+.++|.++||++|.||+|+||++||||++.+-. .+.+..|++||+++++|+.+....+.. ........
T Consensus 133 l~~l~-~v~~~h~~lFY~~g~~y~IskRltgI~yv~~~~~~~~~~~~~q~y~iLg~I~L~ql~~slg~r~~~s~~q~~~s 211 (293)
T KOG0317|consen 133 LRGLF-AVLRAHKALFYINGSFYSISKRLTGIRYVLARTLKGHEANASQPYKILGYILLIQLLLSLGSRLYASFLQHKRS 211 (293)
T ss_pred hhhHH-HHHHHhhheEEecCchHHHHHhhccceEEEEecccccccccccceeeechhhHHHHHHhhhhHHHHHHHhcccc
Confidence 22233 7889999999999999999999999999999733 355678999999999997776554443 11111000
Q ss_pred ccccccccccccccCCCCCcccCCCCCCCCCCCCCCCccccCCCCcccCCCCCCccccccCCCCCCCeEcCCCCccChhH
Q 018471 245 SSVHHTSLGFQQASTGRGLPVLNEEGSLIPSESDKGGWVLDSTSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNC 324 (355)
Q Consensus 245 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~iC~~~~~~p~~~~CgH~fC~~C 324 (355)
..++.. +.+.... ......++........+|.+|++.+.+|.++||||+|||.|
T Consensus 212 --------------~~e~~~---e~~~~~~---------~~~~s~~~~~i~~a~~kC~LCLe~~~~pSaTpCGHiFCWsC 265 (293)
T KOG0317|consen 212 --------------STESIE---ESKLNHS---------KLEDSNSLSSIPEATRKCSLCLENRSNPSATPCGHIFCWSC 265 (293)
T ss_pred --------------cccccc---ccccccc---------chhhccCCccCCCCCCceEEEecCCCCCCcCcCcchHHHHH
Confidence 000000 0000000 00011222234567899999999999999999999999999
Q ss_pred HHHHHhcCCCCCCCCCCCCCCCceeccC
Q 018471 325 IMEWCNEKPECPLCRAPITHSSLVCLYH 352 (355)
Q Consensus 325 i~~~~~~~~~CP~Cr~~~~~~~~~~l~~ 352 (355)
|.+|+.++.+||+||..+++++++.|+|
T Consensus 266 I~~w~~ek~eCPlCR~~~~pskvi~Lr~ 293 (293)
T KOG0317|consen 266 ILEWCSEKAECPLCREKFQPSKVICLRH 293 (293)
T ss_pred HHHHHccccCCCcccccCCCcceeeecC
Confidence 9999999999999999999999999986
|
|
| >PF04757 Pex2_Pex12: Pex2 / Pex12 amino terminal region; InterPro: IPR006845 This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3113 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3899 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 355 | ||||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 3e-06 | ||
| 2ecn_A | 70 | Solution Structure Of The Ring Domain Of The Human | 6e-05 | ||
| 1chc_A | 68 | Structure Of The C3hc4 Domain By 1h-Nuclear Magneti | 7e-05 | ||
| 4a49_A | 84 | Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Len | 1e-04 | ||
| 2k4d_A | 83 | E2-C-Cbl Recognition Is Necessary But Not Sufficien | 1e-04 | ||
| 2ldr_A | 82 | Solution Structure Of Helix-Ring Domain Of Cbl-B In | 2e-04 | ||
| 4a4c_A | 391 | Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Comp | 4e-04 | ||
| 4a4b_A | 391 | Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Za | 4e-04 | ||
| 2y1m_A | 389 | Structure Of Native C-Cbl Length = 389 | 4e-04 | ||
| 1fbv_A | 388 | Structure Of A Cbl-Ubch7 Complex: Ring Domain Funct | 4e-04 | ||
| 3vgo_A | 394 | Crystal Structure Of The N-Terminal Fragment Of Cbl | 5e-04 | ||
| 4ayc_B | 138 | Rnf8 Ring Domain Structure Length = 138 | 6e-04 |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
|
| >pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 | Back alignment and structure |
| >pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 | Back alignment and structure |
| >pdb|4A49|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Length = 84 | Back alignment and structure |
| >pdb|2K4D|A Chain A, E2-C-Cbl Recognition Is Necessary But Not Sufficient For Ubiquitination Activity Length = 83 | Back alignment and structure |
| >pdb|2LDR|A Chain A, Solution Structure Of Helix-Ring Domain Of Cbl-B In The Tyr363 Phosphorylated Form Length = 82 | Back alignment and structure |
| >pdb|4A4C|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 | Back alignment and structure |
| >pdb|4A4B|A Chain A, Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 | Back alignment and structure |
| >pdb|2Y1M|A Chain A, Structure Of Native C-Cbl Length = 389 | Back alignment and structure |
| >pdb|1FBV|A Chain A, Structure Of A Cbl-Ubch7 Complex: Ring Domain Function In Ubiquitin-Protein Ligases Length = 388 | Back alignment and structure |
| >pdb|3VGO|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Cbl-B Length = 394 | Back alignment and structure |
| >pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
Score = 91.4 bits (227), Expect = 2e-23
Identities = 20/66 (30%), Positives = 28/66 (42%)
Query: 286 STSTSESQAAPGVSKCTLCLSNRQDPTATPCGHVFCWNCIMEWCNEKPECPLCRAPITHS 345
S S+ + + V +C +CL P + PC HVFC+ C+ C LCR I
Sbjct: 3 SGSSGNTAPSLTVPECAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRCALCRQEIPED 62
Query: 346 SLVCLY 351
L
Sbjct: 63 FLDSGP 68
|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 355 | |||
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.41 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.36 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.35 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.33 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.31 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.31 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.3 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.3 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.29 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.28 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.28 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.27 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.27 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.27 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.26 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.26 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.25 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.23 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.22 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.22 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.22 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.18 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.18 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.17 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.16 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.16 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.15 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.15 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.15 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.14 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.13 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.12 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.12 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.11 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.11 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.1 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.09 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.08 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.06 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.05 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.05 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.04 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.02 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.02 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.01 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.01 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.01 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.99 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.98 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.97 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.97 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.96 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.96 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.96 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.93 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.92 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.91 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.86 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.84 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.82 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.82 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.66 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.65 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.64 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.52 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.52 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.33 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.13 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.06 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.8 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.72 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.02 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 95.6 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 93.32 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 92.85 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 92.46 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 86.06 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 80.93 |
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
Probab=99.41 E-value=5.1e-14 Score=103.16 Aligned_cols=56 Identities=32% Similarity=0.835 Sum_probs=51.9
Q ss_pred CCCccccccCCCCCCC-------eEcCCCCccChhHHHHHHhcCCCCCCCCCCCCCCCceecc
Q 018471 296 PGVSKCTLCLSNRQDP-------TATPCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLY 351 (355)
Q Consensus 296 ~~~~~C~iC~~~~~~p-------~~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~l~ 351 (355)
.++..|+||++.+.+| +.++|||+||..||..|+..+..||.||+++..++++++|
T Consensus 8 ~~~~~C~IC~~~~~~~~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~ 70 (71)
T 3ng2_A 8 SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIY 70 (71)
T ss_dssp TTCCBCTTTCCBHHHHHTTTCCEEECTTSCEEEHHHHHHHHHHCSBCTTTCCBCCCCSCCCCC
T ss_pred CCCCCCcccChhhhccccccCCeEeCCCCChHhHHHHHHHHHcCCCCCCCCCccChhheeecc
Confidence 4578999999998776 8889999999999999999889999999999999999987
|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 355 | ||||
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 9e-15 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-14 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-13 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-13 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 2e-12 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 3e-11 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 2e-09 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 2e-09 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 8e-09 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 5e-08 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-07 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-07 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 8e-07 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 2e-06 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 2e-05 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 3e-04 |
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: Immediate early protein, IEEHV species: Equine herpesvirus 1 [TaxId: 10326]
Score = 66.1 bits (161), Expect = 9e-15
Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
Query: 300 KCTLCLSNRQDP-TATPCGHVFCWNCIMEWCNEKPECPLCRAPIT 343
+C +CL + + A PC H FC+ CI W + P CPLC+ P+
Sbjct: 7 RCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVE 51
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 355 | |||
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.42 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.29 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.26 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.26 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.26 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.24 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.17 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.14 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.13 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.09 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.02 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.98 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.86 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.83 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.56 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.88 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 93.26 |
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: U-box domain: Pre-mRNA splicing factor Prp19 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.42 E-value=2.6e-14 Score=98.34 Aligned_cols=53 Identities=11% Similarity=0.292 Sum_probs=49.9
Q ss_pred cccccCCCCCCCeEc-CCCCccChhHHHHHHhcCCCCCCCCCCCCCCCceeccC
Q 018471 300 KCTLCLSNRQDPTAT-PCGHVFCWNCIMEWCNEKPECPLCRAPITHSSLVCLYH 352 (355)
Q Consensus 300 ~C~iC~~~~~~p~~~-~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~l~~ 352 (355)
.|+||++.+.+|+.+ .|||+||+.||.+|++.+..||.||+++..++++++..
T Consensus 2 ~C~Ic~~~~~~Pv~~~~cGh~fc~~cI~~~l~~~~~CP~c~~~l~~~dLipik~ 55 (56)
T d2baya1 2 LCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVP 55 (56)
T ss_dssp CCTTTCSCCSSEEEETTTTEEEEHHHHHHHHHHHSBCTTTCCBCCGGGCEECCC
T ss_pred CCccCCchHHhcCccCCCCCcccHHHHHHHHhhccCCCccCCcCCHHhceeCCC
Confidence 599999999999987 59999999999999998899999999999999999874
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|