Citrus Sinensis ID: 018493

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MMRMKTSKTTGPSPMATMNGGSAEAAAHEWELRPGGMLVQKRNPDSDRTSAPPPTIRVRVKYGSIYHEIHINSQATFGELKKLLTGPTGLHHEDQKLIYKDKERDSKAFLDVVGVKDKSKLVLVEDPISQEKRLLEMRKNAKLEKASKSISEISLEVDRLAGQVSALESIITKGGKVAEKDVLNLIELLMNQLLKLDGIMADGDVKLQRKMQVRRVQKYVETLDMLKIKNSMPSSNKHHSNGQRLAPIQEQPQQQPPRHSNGHVLASIQEQQARHSFENLSIQQQYHQQQQQQQQQQSTTHSTSGPVVVTTKWETFDSSPGLMQVSSSSTSTFNPATNNNNNSSGPPKFPWEFFD

ccccccccccccccccccccccccccccccEEccccEEEEECccccccccccccEEEEEEEEccEEEEEEEcccccHHHHHHHHcccccccccccEEEEccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*******************************LRPGGML*****************IRVRVKYGSIYHEIHINSQATFGELKKLLTGPTGLHHEDQKLIYKDKERDSKAFLDVVGVKDKSKLVLVE**************************EISLEVDRLAGQVSALESIITKGGKVAEKDVLNLIELLMNQLLKLDGIMADGDVKLQRKMQVRRVQKYVETLDMLK***********************************************************************************TKWETF********************************FPWEFFD

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BAG family molecular chaperone regulator 1	Co-chaperone that regulates diverse cellular pathways, such as programmed cell death and stress responses.	probable	Q0WUQ1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I6Z, chain A
Confidence level:confident
Coverage over the Query: 117-230
View the alignment between query and template
View the model in PyMOL

Template: 1WXV, chain A
Confidence level:confident
Coverage over the Query: 52-129
View the alignment between query and template
View the model in PyMOL

Template: 1J8C, chain A
Confidence level:confident
Coverage over the Query: 68-126
View the alignment between query and template
View the model in PyMOL