Citrus Sinensis ID: 018528

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----

MAARVILWALSKRPRCFHRPSISRSISTLVLGEHENGSIKSQSLSAVEAAKSLSDDNSVSMLLAGSGPSFNEAVKHAASSHPSISQVLVADSDKFAYPIAEPWAKLVHMIQQREKYSHIISASGSFGKNVLPRAAALLDVSPITDVIEISGSSQFVRPIYAGNALCTVRYTGANPCMLTVRATSFPMPKSSAESRSNGASISQVDLSALDEDSIGKSRYVKHTSQDAERPDLGSARIVVTGGRGLKSAENFKMIEKLAEKLGAAVGATRAVVDAGFVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGMRDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKFPEKK

cHHHHHHHHHcccccccccccHHccccEEEEEEEcccccccHHHHHHHHHHHccccccCEEEEEcccccHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHcccccccEEEEEcccEEEccccccCEEEEEECcccccCEEEEcccccccccccccccccccEEEEEEcccccccccccEEEEEEEcccccccccccccEEEEccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccccccccEEEEEHHHHHHHHHHccccccEEEEEcccccccccccccEEEHHHHHHHHHHHHHcccccc

*****************HRPSISRSISTLVLGEHENGSIKSQSLSAVEAAKSLSDDNSVSMLLAGSGPSFNEAVKHAASSHPSISQVLVADSDKFAYPIAEPWAKLVHMIQQREKYSHIISASGSFGKNVLPRAAALLDVSPITDVIEISGSSQFVRPIYAGNALCTVRYTGANPCMLTVRATSFP*****************VDLSALDEDSIGKS*************DLGSARIVVTGGRGLKSAENFKMIEKLAEKLGAAVGATRAVVDAGFVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGMRDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKFP***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Electron transfer flavoprotein subunit alpha, mitochondrial	The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase). Involved in leucine catabolism and in phytol degradation.	confident	Q9C6I6
Electron transfer flavoprotein subunit alpha, mitochondrial	The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).	probable	Q75LJ3
Electron transfer flavoprotein subunit alpha, mitochondrial	The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).	probable	Q99LC5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EFV, chain A
Confidence level:very confident
Coverage over the Query: 26-351
View the alignment between query and template
View the model in PyMOL