Citrus Sinensis ID: 018528


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350----
MAARVILWALSKRPRCFHRPSISRSISTLVLGEHENGSIKSQSLSAVEAAKSLSDDNSVSMLLAGSGPSFNEAVKHAASSHPSISQVLVADSDKFAYPIAEPWAKLVHMIQQREKYSHIISASGSFGKNVLPRAAALLDVSPITDVIEISGSSQFVRPIYAGNALCTVRYTGANPCMLTVRATSFPMPKSSAESRSNGASISQVDLSALDEDSIGKSRYVKHTSQDAERPDLGSARIVVTGGRGLKSAENFKMIEKLAEKLGAAVGATRAVVDAGFVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGMRDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKFPEKK
cHHHHHHHHHcccccccccccHHccccEEEEEEEcccccccHHHHHHHHHHHccccccCEEEEEcccccHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHcccccccEEEEEcccEEEccccccCEEEEEECcccccCEEEEcccccccccccccccccccEEEEEEcccccccccccEEEEEEEcccccccccccccEEEEccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccccccccEEEEEHHHHHHHHHHccccccEEEEEcccccccccccccEEEHHHHHHHHHHHHHcccccc
*****************HRPSISRSISTLVLGEHENGSIKSQSLSAVEAAKSLSDDNSVSMLLAGSGPSFNEAVKHAASSHPSISQVLVADSDKFAYPIAEPWAKLVHMIQQREKYSHIISASGSFGKNVLPRAAALLDVSPITDVIEISGSSQFVRPIYAGNALCTVRYTGANPCMLTVRATSFP*****************VDLSALDEDSIGKS*************DLGSARIVVTGGRGLKSAENFKMIEKLAEKLGAAVGATRAVVDAGFVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGMRDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKFP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARVILWALSKRPRCFHRPSISRSISTLVLGEHENGSIKSQSLSAVEAAKSLSDDNSVSMLLAGSGPSFNEAVKHAASSHPSISQVLVADSDKFAYPIAEPWAKLVHMIQQREKYSHIISASGSFGKNVLPRAAALLDVSPITDVIEISGSSQFVRPIYAGNALCTVRYTGANPCMLTVRATSFPMPKSSAESRSNGASISQVDLSALDEDSIGKSRYVKHTSQDAERPDLGSARIVVTGGRGLKSAENFKMIEKLAEKLGAAVGATRAVVDAGFVPNDLQVGQTGKIVAPELYMAFGVSGAIQHLAGMRDSKVIVAVNKDADAPIFQVADYGLVGDLFEVIPELLEKFPEKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Electron transfer flavoprotein subunit alpha, mitochondrial The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase). Involved in leucine catabolism and in phytol degradation.confidentQ9C6I6
Electron transfer flavoprotein subunit alpha, mitochondrial The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).probableQ75LJ3
Electron transfer flavoprotein subunit alpha, mitochondrial The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).probableQ99LC5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EFV, chain A
Confidence level:very confident
Coverage over the Query: 26-351
View the alignment between query and template
View the model in PyMOL