Citrus Sinensis ID: 018643


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MGTGEENTSAKTAKTASSTQEIPTTPSYADWSSSMQAFYGAGATPPPFFASTVASPTPHPYLWGSQHPLMPPYGTPVPYQAIYPPGGVYAHPSMATTPTAAPTNTEPEGKGPEAKDRASAKKSKGTPGGKAGEIVKATSGSGNDGVSQSAESGSDGSSDASDENGNQQEFARGKKGSFDKMLADANTENNTAEAVPGSVPGKPVVSMPATNLNIGMDLWNTSPAAAGAAKMRTNPSGASPAVAPAGIMPDQWIQDERELKRQKRKQSNRESARRSRLRKQAECEELQARVETLSNENRNLRDELQRLSEECEKLTSENNSIKEDLSRLCGPEAVANLEQSNPTQSCGEEENS
ccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccccc
******************************WSSSMQAFYGAGATPPPFFASTVASPTPHPYLWGSQHPLMPPYGTPVPYQAIYPPGGVYA**************************************************************************************************************************NI*******************************************************************ECEELQARVETLSNENRNLRDELQRLSEECEKLTSENNSIKED****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTGEENTSAKTAKTASSTQEIPTTPSYADWSSSMQAFYGAGATPPPFFASTVASPTPHPYLWGSQHPLMPPYGTPVPYQAIYPPGGVYAHPSMATTPTAAPTNTEPEGKGPEAKDRASAKKSKGTPGGKAGEIVKATSGSGNDGVSQSAESGSDGSSDASDENGNQQEFARGKKGSFDKMLADANTENNTAEAVPGSVPGKPVVSMPATNLNIGMDLWNTSPAAAGAAKMRTNPSGASPAVAPAGIMPDQWIQDERELKRQKRKQSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSRLCGPEAVANLEQSNPTQSCGEEENS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G-box-binding factor 1 Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.probableP42774

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GD2, chain E
Confidence level:confident
Coverage over the Query: 280-321
View the alignment between query and template
View the model in PyMOL
Template: 3M9B, chain A
Confidence level:confident
Coverage over the Query: 287-342
View the alignment between query and template
View the model in PyMOL