Citrus Sinensis ID: 018675

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350--
MEFLDDGNYELREIQTLEGHTDRVWSLAWKPTAGVDGVAPVFASCSGDKTVRIWEQSASSRFWNCKAVLEEMHTRTVRSCAWSPSGKLLATASFDATTCIWEDVGGDYECVATLEGHENEVKSVSWNASGTLLATCGRDKSVWIWEVMPGNEFECVSVLQGHAQDVKMVQWHPTMDVLFSCSYDNTIKVWWAEDTDSDNWHCVQTISESNNGHSSTIWALSFNAKGDKLVSCSDDLTIKIWGADITRMQSGDGYASWRHLCTISGYHDRTIFSVHWSREGIIASGAADDSVQFFVESKDDLIDGPSYKMLLKKEKAHDMDVNSVQWSPGERRLLASASDDGMIKIWELANTL
ccCECcccccEEEEEEEccccccEEEEEEcccccccccccEEEEECccccEEEEEcccccEEEEEcccccccccccEEEEEEcccccEEEEECccccEEEEccccccCEEcEEECcccccEEEEEEcccccEEEEECccccEEEEEcccccccCEccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccCEEEEcccccccccccEEEEEEcccccEEEEECccccEEEEcccccccccccccccEEEEEEEcccccccEEEEEEcccccEEEEcccccEEEEEccccccccccccEEcccccccccccEEEEEEccccccEEEEECccccEEEEEccccc
MEFLDDGNYELREIQTLEGHTDRVWSLAWKPTAGVDGVAPVFASCSGDKTVRIWEQSASSRFWNCKAVLEEMHTRTVRSCAWSPSGKLLATASFDATTCIWEDVGGDYECVATLEGHENEVKSVSWNASGTLLATCGRDKSVWIWEVMPGNEFECVSVLQGHAQDVKMVQWHPTMDVLFSCSYDNTIKVWWAEDTDSDNWHCVQTISESNNGHSSTIWALSFNAKGDKLVSCSDDLTIKIWGADITRMQSGDGYASWRHLCTISGYHDRTIFSVHWSREGIIASGAADDSVQFFVESKDDLIDGPSYKMLLKKEKAHDMDVNSVQWSPGERRLLASASDDGMIKIWELANTL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFLDDGNYELREIQTLEGHTDRVWSLAWKPTAGVDGVAPVFASCSGDKTVRIWEQSASSRFWNCKAVLEEMHTRTVRSCAWSPSGKLLATASFDATTCIWEDVGGDYECVATLEGHENEVKSVSWNASGTLLATCGRDKSVWIWEVMPGNEFECVSVLQGHAQDVKMVQWHPTMDVLFSCSYDNTIKVWWAEDTDSDNWHCVQTISESNNGHSSTIWALSFNAKGDKLVSCSDDLTIKIWGADITRMQSGDGYASWRHLCTISGYHDRTIFSVHWSREGIIASGAADDSVQFFVESKDDLIDGPSYKMLLKKEKAHDMDVNSVQWSPGERRLLASASDDGMIKIWELANTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cytosolic iron-sulfur protein assembly protein Ciao1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.probableQ292E8
Probable cytosolic iron-sulfur protein assembly protein Ciao1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.probableQ7K1Y4
Probable cytosolic iron-sulfur protein assembly protein Ciao1 Essential component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for the maturation of extramitochondrial Fe/S proteins.probableQ7PS24

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MKQ, chain A
Confidence level:very confident
Coverage over the Query: 12-247,259-349
View the alignment between query and template
View the model in PyMOL
Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 11-350
View the alignment between query and template
View the model in PyMOL