Citrus Sinensis ID: 018701

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-

MASEREDFSLSGPLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWWEFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPDSFSRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLFMNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQLKSQLYSYK

ccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccccEEEEEEccccccccccccccccccccEEEEEEccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHcccccccEEEccccHHHHHHHHHHHccccccccccccccccccccEEEEccccccccccccHHHHHHHHHHHcccHHHHHHHHccccHHHHHHccccccccccccccccccEEEEEccccccccccccccccccccccccEEEEEccc

ccccccHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHcccEEEEEEcccccccEEEEEEEEccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHccccccccccccccccccEEEEEEccccHHHHHHcccHHccccccHHHHEHHccc

maseredfslsgplhlsaidwtnvhHRRSVAACLVQGVYILERDRqlqrhesqalappwWEFFQFKLLHqlkddadfsifgaiyefkpppshshsdlskdgiprYVIAFRgtltkpdsfsrdleLDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEaylfnppfvsapierikdKRVKHGIRIAGSVITAGLALAAKINhhntrlsedpflalsawvpclfvnpaddicsEYIGYFEHRKKMEEIGAGAIEKLATQHSLgglfmnaigkgnvantseplhlipsanlivnstpardlkeahgihqwwkpdvqlksqlysyk

maseredfslsgpLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWWEFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGtltkpdsfsrDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLFMNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHgihqwwkpdvqlKSQLYSYK

************PLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWWEFFQFKLLHQLKDDADFSIFGAIYEF**************GIPRYVIAFRGTLTKPDSFSRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLFMNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQL********

******D**LSGPLHLSAIDWTNVHHRRSVAACLVQGVYILER**********ALAPPWWEFFQFKLLHQLKDDADFSIFGAIYEFKPPPS********DGIPRYVIAFRGTLTKPDSFSRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAG********************ALSAWVPCLFVNPADDICSEYIGYFEHRKKM*************************************HLIPSANLIVNSTPA***KEAHGIHQWWKPDVQLK*******

**********SGPLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWWEFFQFKLLHQLKDDADFSIFGAIYEFKP********LSKDGIPRYVIAFRGTLTKPDSFSRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLFMNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQLKSQLYSYK

*********LSGPLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWWEFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPDSFSRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLFMNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQLKSQLYS**

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		351	2.2.26 [Sep-21-2011]
Q680C0		350	GDSL esterase/lipase At4g	yes	no	0.974	0.977	0.622	1e-130

>sp\|Q680C0\|GDL62_ARATH GDSL esterase/lipase At4g10955 OS=Arabidopsis thaliana GN=At4g10955 PE=2 SV=1	Back alignment and function desciption

 Score =  464 bits (1194), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 223/358 (62%), Positives = 275/358 (76%), Gaps = 16/358 (4%)

Query: 1   MASEREDFSLSGPLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQ-ALAPPW 59
           M SER+DFSL+GPLHL++IDW N HHRRSVA  LVQG+Y+ ERDRQLQR   + AL+P W
Sbjct: 2   MISERDDFSLTGPLHLTSIDWANEHHRRSVAGSLVQGIYVAERDRQLQREGPELALSPIW 61

Query: 60  WEFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPDSF 119
            EFF F+L+ +  DDAD SIFG IYE+K P   S +  S +  PR+VIAFRGT+TK DS 
Sbjct: 62  SEFFHFRLIRKFVDDADNSIFGGIYEYKLPQQLSQTVKSMEFSPRFVIAFRGTVTKVDSI 121

Query: 120 SRDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVA 179
           SRD+E D+H+IRNGLH T+RFEIAIQAVRN+VASVG S+VWLAGHSLG++MA+L GKT+A
Sbjct: 122 SRDIEHDIHVIRNGLHTTTRFEIAIQAVRNIVASVGGSSVWLAGHSLGASMALLTGKTIA 181

Query: 180 KTGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSE-- 237
           +TG F E + FNPPF+SAPIE+IKDKR+KHGIRIAGSVITAGLALA K   H ++     
Sbjct: 182 RTGFFPECFAFNPPFLSAPIEKIKDKRIKHGIRIAGSVITAGLALAKKATQHYSQNDRAL 241

Query: 238 ----DPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLF 293
               DPF ALS W P L+VNP D +CSEY+GYFEHR KMEEIG G +E++ATQHSLGG+ 
Sbjct: 242 PAPPDPFEALSDWFPRLYVNPGDHLCSEYVGYFEHRNKMEEIGIGFVERVATQHSLGGML 301

Query: 294 MNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQLKSQLYSYK 351
           +            EP+HLIPS+ L VN + +RD K+AHGIHQWW+ D + ++++Y YK
Sbjct: 302 LGG---------QEPVHLIPSSVLTVNLSSSRDFKQAHGIHQWWREDNKFETKVYQYK 350

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		351
224058229		343	predicted protein [Populus trichocarpa]	0.977	1.0	0.746	1e-152
224072212		364	predicted protein [Populus trichocarpa]	0.977	0.942	0.743	1e-151
255537815		357	triacylglycerol lipase, putative [Ricinu	0.982	0.966	0.704	1e-146
356523549		343	PREDICTED: GDSL esterase/lipase At4g1095	0.977	1.0	0.715	1e-143
324329845		342	triacylglycerol lipase 3 [Arachis hypoga	0.974	1.0	0.694	1e-141
356513277		343	PREDICTED: GDSL esterase/lipase At4g1095	0.977	1.0	0.712	1e-141
449452218		346	PREDICTED: GDSL esterase/lipase At4g1095	0.977	0.991	0.684	1e-141
356495719		384	PREDICTED: GDSL esterase/lipase At4g1095	0.977	0.893	0.697	1e-141
388512187		344	unknown [Medicago truncatula]	0.980	1.0	0.709	1e-140
217074430		344	unknown [Medicago truncatula]	0.980	1.0	0.706	1e-140

>gi\|224058229\|ref\|XP_002299467.1\| predicted protein [Populus trichocarpa] gi\|222846725\|gb\|EEE84272.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 262/351 (74%), Positives = 301/351 (85%), Gaps = 8/351 (2%)

Query: 1   MASEREDFSLSGPLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWW 60
           MASE+EDFSLSGPLHL+ +DWTN HHRRSVAA LVQGVYILERDRQL+R   QALA PWW
Sbjct: 1   MASEKEDFSLSGPLHLAIVDWTNAHHRRSVAASLVQGVYILERDRQLKRQGPQALASPWW 60

Query: 61  EFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPDSFS 120
           EFF F+LL  L DD D SIF AIYEFKPP SH H+ L  D  PRYVIAFRGT+TKP+S S
Sbjct: 61  EFFHFQLLRHLVDDVDSSIFAAIYEFKPPKSHYHNSL--DESPRYVIAFRGTITKPESVS 118

Query: 121 RDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAK 180
           RDLELD+H++RNGLH TSRFEIAIQAVRN+VA+VG SNVWLAGHSLG+AMA+LAGKT+AK
Sbjct: 119 RDLELDLHILRNGLHETSRFEIAIQAVRNVVATVGESNVWLAGHSLGAAMALLAGKTMAK 178

Query: 181 TGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNTRLSEDPF 240
           TG+FL+A+LFN PF SAPIERIKD+RVKHG+RIA SVITAGLA A K ++HN R S DPF
Sbjct: 179 TGIFLQAFLFNSPFFSAPIERIKDERVKHGLRIASSVITAGLAFATKKSYHNNR-SVDPF 237

Query: 241 LALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIGAGAIEKLATQHSLGGLFMNAIGKG 300
            ALSAW+P LFVNP D +CSEYIGY EHRKKM++IG GAIE+LATQ+SLGGL M+A+G+ 
Sbjct: 238 AALSAWIPFLFVNPGDHLCSEYIGYLEHRKKMDDIGIGAIERLATQNSLGGLLMSAMGR- 296

Query: 301 NVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQLKSQLYSYK 351
                SEPLHLIPSANLIVN TP +D +EAHGIHQWW+PD+ +KS+LY+YK
Sbjct: 297 ----DSEPLHLIPSANLIVNLTPCQDFREAHGIHQWWRPDLDIKSKLYNYK 343

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224072212\|ref\|XP_002303655.1\| predicted protein [Populus trichocarpa] gi\|222841087\|gb\|EEE78634.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255537815\|ref\|XP_002509974.1\| triacylglycerol lipase, putative [Ricinus communis] gi\|223549873\|gb\|EEF51361.1\| triacylglycerol lipase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356523549\|ref\|XP_003530400.1\| PREDICTED: GDSL esterase/lipase At4g10955-like [Glycine max]	Back alignment and taxonomy information

>gi\|324329845\|gb\|ADY38375.1\| triacylglycerol lipase 3 [Arachis hypogaea]	Back alignment and taxonomy information

>gi\|356513277\|ref\|XP_003525340.1\| PREDICTED: GDSL esterase/lipase At4g10955-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|449452218\|ref\|XP_004143857.1\| PREDICTED: GDSL esterase/lipase At4g10955-like [Cucumis sativus] gi\|449509371\|ref\|XP_004163569.1\| PREDICTED: GDSL esterase/lipase At4g10955-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356495719\|ref\|XP_003516721.1\| PREDICTED: GDSL esterase/lipase At4g10955-like [Glycine max]	Back alignment and taxonomy information

>gi\|388512187\|gb\|AFK44155.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|217074430\|gb\|ACJ85575.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		351
TAIR\|locus:2051289		358	AT2G05260 [Arabidopsis thalian	0.988	0.969	0.604	2.6e-118
TAIR\|locus:505006437		350	AT4G10955 [Arabidopsis thalian	0.974	0.977	0.628	4.2e-118
TAIR\|locus:2169764		369	AT5G24230 [Arabidopsis thalian	0.962	0.915	0.545	1.3e-98
TAIR\|locus:2151842		375	AT5G24180 [Arabidopsis thalian	0.951	0.890	0.447	1.7e-73
TAIR\|locus:2169754		376	AT5G24220 [Arabidopsis thalian	0.945	0.882	0.434	2e-72
TAIR\|locus:2151852		344	AT5G24200 [Arabidopsis thalian	0.943	0.962	0.419	2.3e-71
TAIR\|locus:2169809		350	AT5G24210 [Arabidopsis thalian	0.965	0.968	0.390	5.1e-58
TAIR\|locus:2157343		408	AT5G50890 [Arabidopsis thalian	0.578	0.497	0.369	4.2e-47
TAIR\|locus:2151847		245	AT5G24190 [Arabidopsis thalian	0.626	0.897	0.404	1.4e-41

TAIR\|locus:2051289 AT2G05260 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1165 (415.2 bits), Expect = 2.6e-118, P = 2.6e-118
 Identities = 219/362 (60%), Positives = 277/362 (76%)

Query:     1 MASEREDFSLSGPLHLSAIDWTNVHHRRSVAACLVQGVYILERDRQLQRHESQALAPPWW 60
             MAS+RE+F+L GP HL+ +DW N  H+R VAACLVQG+YI+E+DRQL+R  ++ALA PWW
Sbjct:     1 MASDREEFNLCGPTHLTTVDWGNEDHQRCVAACLVQGIYIVEQDRQLKREGTEALASPWW 60

Query:    61 EFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPDSFS 120
             E F FKL+  LKDDADFSIFG I+E+K        D+   G+PRYVIAFRGTLTK DS +
Sbjct:    61 ESFNFKLIRHLKDDADFSIFGGIFEYKS----LQPDVVDSGVPRYVIAFRGTLTKADSIT 116

Query:   121 RDLELDVHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHSLGSAMAMLAGKTVAK 180
             RD+ELD+H+IRNGLH TSRFEIA+QAVR+M  SVG+S+ WL GHSLG+AMA+LAGKT+ K
Sbjct:   117 RDIELDIHIIRNGLHRTSRFEIAMQAVRSMADSVGASSFWLTGHSLGAAMALLAGKTMGK 176

Query:   181 TGVFLEAYLFNPPFVSAPIERIKDKRVKHGIRIAGSVITAGLALAAKINHHNT------- 233
             +GV++++ LFNPP+VS PIERI ++RV+HGIR AGS+ITAGLAL+  +            
Sbjct:   177 SGVYIKSLLFNPPYVSPPIERIANERVRHGIRFAGSLITAGLALSRTLKQTQQPQQQQLQ 236

Query:   234 --RLSEDPFLALSAWVPCLFVNPADDICSEYIGYFEHRKKMEEIG--AGAIEKLATQHSL 289
                L+EDP  ALS+W+P + VNP D +CSEYIG+FEHR  ME+IG  AG +E++A QHSL
Sbjct:   237 LQNLTEDPLEALSSWLPNIHVNPGDHLCSEYIGFFEHRGNMEQIGYGAGIVERMAMQHSL 296

Query:   290 GGLFMNAIGKGNVANTSEPLHLIPSANLIVNSTPARDLKEAHGIHQWWKPDVQLKSQLYS 349
             GGL M+A+G  N     EP+H+IPSANLIVN T + D K+AHGIHQWW+ D  L S +Y 
Sbjct:   297 GGLLMDAMGVSNAVEVEEPVHVIPSANLIVNKTISEDYKDAHGIHQWWRDDQDLVSHIYM 356

Query:   350 YK 351
             YK
Sbjct:   357 YK 358

GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS

GO:0005634 "nucleus" evidence=ISM

GO:0006629 "lipid metabolic process" evidence=IEA;ISS

TAIR\|locus:505006437 AT4G10955 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169764 AT5G24230 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2151842 AT5G24180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169754 AT5G24220 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2151852 AT5G24200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2169809 AT5G24210 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2157343 AT5G50890 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2151847 AT5G24190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q680C0	GDL62_ARATH	3, ., 1, ., 1, ., -	0.6229	0.9743	0.9771	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.1	0.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		351
cd00519		229	cd00519, Lipase_3, Lipase (class 3)	2e-06
pfam01764		141	pfam01764, Lipase_3, Lipase (class 3)	4e-05
cd00741		153	cd00741, Lipase, Lipase	7e-04

>gnl\|CDD\|238287 cd00519, Lipase_3, Lipase (class 3)	Back alignment and domain information

 Score = 47.9 bits (114), Expect = 2e-06
 Identities = 29/104 (27%), Positives = 43/104 (41%), Gaps = 15/104 (14%)

Query: 106 VIAFRGTLTKPDSFSRDL-----ELDVHLIRNGL-H------LTSRFEIAIQAVRNMVAS 153
           VIAFRGT++  D  + DL      LD  L   G  H        S +   +  +++ +  
Sbjct: 66  VIAFRGTVSLADWLT-DLDFSPVPLDPPLCSGGKVHSGFYSAYKSLYNQVLPELKSALKQ 124

Query: 154 VGSSNVWLAGHSLGSAMAMLAGKTVAKTGVF--LEAYLFNPPFV 195
                + + GHSLG A+A L    +   G    +  Y F  P V
Sbjct: 125 YPDYKIIVTGHSLGGALASLLALDLRLRGPGSDVTVYTFGQPRV 168

Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. . Length = 229

>gnl\|CDD\|216688 pfam01764, Lipase_3, Lipase (class 3)	Back alignment and domain information

>gnl\|CDD\|238382 cd00741, Lipase, Lipase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		351
PLN02324		415	triacylglycerol lipase	99.97
PLN02454		414	triacylglycerol lipase	99.96
PLN02310		405	triacylglycerol lipase	99.96
PLN02408		365	phospholipase A1	99.96
PLN02802		509	triacylglycerol lipase	99.96
PLN02761		527	lipase class 3 family protein	99.96
PLN02719		518	triacylglycerol lipase	99.96
PLN02571		413	triacylglycerol lipase	99.95
PLN02753		531	triacylglycerol lipase	99.95
PLN03037		525	lipase class 3 family protein; Provisional	99.94
KOG4569		336	consensus Predicted lipase [Lipid transport and me	99.85
PLN02162		475	triacylglycerol lipase	99.84
PLN02934		515	triacylglycerol lipase	99.84
cd00519		229	Lipase_3 Lipase (class 3). Lipases are esterases t	99.83
PLN00413		479	triacylglycerol lipase	99.83
PF01764		140	Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr	99.8
PLN02847		633	triacylglycerol lipase	99.49
cd00741		153	Lipase Lipase. Lipases are esterases that can hydr	99.43
PF11187		224	DUF2974: Protein of unknown function (DUF2974); In	99.29
COG5153		425	CVT17 Putative lipase essential for disintegration	99.0
KOG4540		425	consensus Putative lipase essential for disintegra	99.0
COG3675		332	Predicted lipase [Lipid metabolism]	97.86
PF07819		225	PGAP1: PGAP1-like protein; InterPro: IPR012908 The	97.11
PF00975		229	Thioesterase: Thioesterase domain; InterPro: IPR00	96.72
PF05057		217	DUF676: Putative serine esterase (DUF676); InterPr	96.6
PRK11071		190	esterase YqiA; Provisional	96.25
PF05728		187	UPF0227: Uncharacterised protein family (UPF0227);	96.04
PRK10985		324	putative hydrolase; Provisional	95.75
TIGR02427		251	protocat_pcaD 3-oxoadipate enol-lactonase. Members	95.74
PF12697		228	Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3	95.65
PRK11126		242	2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl	95.64
TIGR03695		251	menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene	95.64
PF00561		230	Abhydrolase_1: alpha/beta hydrolase fold A web pag	95.62
PLN02965		255	Probable pheophorbidase	95.47
PF01083		179	Cutinase: Cutinase; InterPro: IPR000675 Aerial pla	95.46
PLN02733		440	phosphatidylcholine-sterol O-acyltransferase	95.44
PHA02857		276	monoglyceride lipase; Provisional	95.36
PLN02824		294	hydrolase, alpha/beta fold family protein	95.32
PRK10673		255	acyl-CoA esterase; Provisional	95.26
COG2267		298	PldB Lysophospholipase [Lipid metabolism]	95.25
TIGR03611		257	RutD pyrimidine utilization protein D. This protei	95.2
PRK10749		330	lysophospholipase L2; Provisional	95.16
TIGR02240		276	PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer	95.13
cd00707		275	Pancreat_lipase_like Pancreatic lipase-like enzyme	95.12
COG3675		332	Predicted lipase [Lipid metabolism]	95.08
KOG2564		343	consensus Predicted acetyltransferases and hydrola	95.04
PRK00870		302	haloalkane dehalogenase; Provisional	94.83
KOG2088		596	consensus Predicted lipase/calmodulin-binding heat	94.76
TIGR01250		288	pro_imino_pep_2 proline-specific peptidases, Bacil	94.76
TIGR03056		278	bchO_mg_che_rel putative magnesium chelatase acces	94.6
PLN02511		388	hydrolase	94.55
TIGR03343		282	biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die	94.47
PRK04940		180	hypothetical protein; Provisional	94.19
PRK03592		295	haloalkane dehalogenase; Provisional	94.17
PRK03204		286	haloalkane dehalogenase; Provisional	94.1
TIGR01607		332	PST-A Plasmodium subtelomeric family (PST-A). Thes	94.1
COG3319		257	Thioesterase domains of type I polyketide synthase	93.91
PLN02211		273	methyl indole-3-acetate methyltransferase	93.89
TIGR01738		245	bioH putative pimeloyl-BioC--CoA transferase BioH.	93.86
TIGR01836		350	PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth	93.78
PF00151		331	Lipase: Lipase; InterPro: IPR013818 Triglyceride l	93.74
PLN02298		330	hydrolase, alpha/beta fold family protein	93.71
PLN02385		349	hydrolase; alpha/beta fold family protein	93.68
PRK13604		307	luxD acyl transferase; Provisional	93.67
PF12695		145	Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3	93.47
PRK14875		371	acetoin dehydrogenase E2 subunit dihydrolipoyllysi	93.37
TIGR01249		306	pro_imino_pep_1 proline iminopeptidase, Neisseria-	93.37
PF02450		389	LCAT: Lecithin:cholesterol acyltransferase; InterP	93.34
TIGR01392		351	homoserO_Ac_trn homoserine O-acetyltransferase. Th	93.19
PRK10349		256	carboxylesterase BioH; Provisional	93.07
TIGR01838		532	PHA_synth_I poly(R)-hydroxyalkanoic acid synthase,	93.07
PF07859		211	Abhydrolase_3: alpha/beta hydrolase fold A web pag	92.84
KOG3724		973	consensus Negative regulator of COPII vesicle form	92.68
TIGR03101		266	hydr2_PEP hydrolase, ortholog 2, exosortase system	92.63
PF00326		213	Peptidase_S9: Prolyl oligopeptidase family This fa	92.58
PLN02652		395	hydrolase; alpha/beta fold family protein	92.55
PLN02894		402	hydrolase, alpha/beta fold family protein	92.46
PLN02578		354	hydrolase	92.43
COG3208		244	GrsT Predicted thioesterase involved in non-riboso	92.37
PF05277		345	DUF726: Protein of unknown function (DUF726); Inte	92.34
TIGR02821		275	fghA_ester_D S-formylglutathione hydrolase. This m	92.33
PF06342		297	DUF1057: Alpha/beta hydrolase of unknown function	92.32
TIGR01840		212	esterase_phb esterase, PHB depolymerase family. Th	92.27
PF06259		177	Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR	92.26
TIGR03100		274	hydr1_PEP hydrolase, ortholog 1, exosortase system	92.2
PLN02679		360	hydrolase, alpha/beta fold family protein	92.2
PF10230		266	DUF2305: Uncharacterised conserved protein (DUF230	92.1
PRK08775		343	homoserine O-acetyltransferase; Provisional	91.94
PRK10566		249	esterase; Provisional	91.91
COG0596		282	MhpC Predicted hydrolases or acyltransferases (alp	91.79
smart00824		212	PKS_TE Thioesterase. Peptide synthetases are invol	91.34
TIGR03230		442	lipo_lipase lipoprotein lipase. Members of this pr	91.29
PLN03087		481	BODYGUARD 1 domain containing hydrolase; Provision	91.22
PRK00175		379	metX homoserine O-acetyltransferase; Provisional	91.04
PRK06489		360	hypothetical protein; Provisional	90.94
PLN02442		283	S-formylglutathione hydrolase	90.86
KOG1454		326	consensus Predicted hydrolase/acyltransferase (alp	90.75
PRK10162		318	acetyl esterase; Provisional	90.71
COG3150		191	Predicted esterase [General function prediction on	90.64
PF11288		207	DUF3089: Protein of unknown function (DUF3089); In	89.86
KOG1455		313	consensus Lysophospholipase [Lipid transport and m	89.58
PLN00021		313	chlorophyllase	89.51
PRK11460		232	putative hydrolase; Provisional	89.5
PRK07581		339	hypothetical protein; Validated	89.46
PRK05855		582	short chain dehydrogenase; Validated	89.38
KOG4409		365	consensus Predicted hydrolase/acyltransferase (alp	88.91
PF06028		255	DUF915: Alpha/beta hydrolase of unknown function (	88.59
PRK06765		389	homoserine O-acetyltransferase; Provisional	88.46
PF08237		225	PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum	87.92
PF05990		233	DUF900: Alpha/beta hydrolase of unknown function (	87.91
PF10503		220	Esterase_phd: Esterase PHB depolymerase	87.15
PF05448		320	AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0	87.13
COG3545		181	Predicted esterase of the alpha/beta hydrolase fol	87.05
COG0429		345	Predicted hydrolase of the alpha/beta-hydrolase fo	86.68
PTZ00472		462	serine carboxypeptidase (CBP1); Provisional	86.17
PLN02517		642	phosphatidylcholine-sterol O-acyltransferase	85.4
COG1075		336	LipA Predicted acetyltransferases and hydrolases w	85.33
PRK05077		414	frsA fermentation/respiration switch protein; Revi	85.28
PF05677		365	DUF818: Chlamydia CHLPS protein (DUF818); InterPro	84.96
PLN03084		383	alpha/beta hydrolase fold protein; Provisional	84.72
COG0657		312	Aes Esterase/lipase [Lipid metabolism]	83.8
PLN02980		1655	2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi	83.8
PF01674		219	Lipase_2: Lipase (class 2); InterPro: IPR002918 Li	82.93
PF03403		379	PAF-AH_p_II: Platelet-activating factor acetylhydr	82.47
TIGR01839		560	PHA_synth_II poly(R)-hydroxyalkanoic acid synthase	81.52
KOG4627		270	consensus Kynurenine formamidase [Amino acid trans	81.08
PLN02872		395	triacylglycerol lipase	81.03
PF00756		251	Esterase: Putative esterase; InterPro: IPR000801 T	80.8

>PLN02324 triacylglycerol lipase	Back alignment and domain information

Probab=99.97  E-value=5.8e-30  Score=254.37  Aligned_cols=235  Identities=16%  Similarity=0.150  Sum_probs=155.8

Q ss_pred             CCC------CccccHHHH--HHHHHhhhhhh-hhhhh-----hhcccccCC----CCCcccccceeeeeeecCCCcceee
Q 018701           20 DWT------NVHHRRSVA--ACLVQGVYILE-RDRQL-----QRHESQALA----PPWWEFFQFKLLHQLKDDADFSIFG   81 (351)
Q Consensus        20 ~w~------~~~~rr~v~--a~Lvq~vY~~~-~dr~~-----~r~~~~~la----p~ww~~f~f~l~~~l~d~~d~si~g   81 (351)
                      +|+      |+++||.|+  ++||||+|+.. .|+.+     +|++...+-    -+--.+++|+++++||++++-.+..
T Consensus        17 ~W~glldPld~~LR~~iirYGe~~qa~Ydaf~~d~~s~~~g~~ry~~~~~~~~~~~~~~~~~~Y~vT~~lYAts~~~~p~   96 (415)
T PLN02324         17 KWKGLLDPLDPDLRRYIIHYGEMSQVGYDAFNWDRKSKYAGDCYYSKNELFARTGFLKANPFRYEVTKYIYATASIKLPI   96 (415)
T ss_pred             chhhccCcCCHHHHHHHHHHHHHHHHHHHHhccCccCccccccccchhhHHHhhcccccCCCCceEEEEEEeccCCCCcc
Confidence            587      789999999  88999999994 44433     333322110    0001467899999999987655444


Q ss_pred             eEeeeC--CCCCCCCCCC------------CCCCCCeEEEEEcCCCCCcccccccccccccc----c--c-----ccccc
Q 018701           82 AIYEFK--PPPSHSHSDL------------SKDGIPRYVIAFRGTLTKPDSFSRDLELDVHL----I--R-----NGLHL  136 (351)
Q Consensus        82 av~e~~--~~~~~~~~~~------------~~~~~~~iVIAfRGT~~~~d~~~~Dl~~dl~~----~--~-----~~lh~  136 (351)
                      ++....  ...+...+++            ...++++||||||||.+..||+. |+.+.+..    +  .     -.+|.
T Consensus        97 ~f~~~~~~~~~w~~~s~w~GYVAv~~d~~~~~lGrrdIVVafRGT~t~~eWi~-Dl~~~~~~~~~~~p~~~~~~~~kVH~  175 (415)
T PLN02324         97 CFIVKSLSKDASRVQTNWMGYIAVATDQGKAMLGRRDIVVAWRGTLQPYEWAN-DFDFPLESAISVFPVTDPKDNPRIGS  175 (415)
T ss_pred             hhhcccccccccccccceeEEEEEeCCccccccCCceEEEEEccCCCHHHHHH-HhccccccccccCCCCCCCCCceeeh
Confidence            321111  1111111222            12456799999999999999999 98875531    0  0     02333


Q ss_pred             c-----------------hHHHHHHHHHHHHHHHhCC--ccEEEeecchhHHHHHHHHHHHHhc------------CCce
Q 018701          137 T-----------------SRFEIAIQAVRNMVASVGS--SNVWLAGHSLGSAMAMLAGKTVAKT------------GVFL  185 (351)
Q Consensus       137 ~-----------------~~f~~a~~~v~~~~~~~~~--~~I~itGHSLGGALA~L~a~~l~~~------------g~~v  185 (351)
                      .                 +...+++++|++++++||+  ++|+|||||||||||+|+|.+++.+            +.+|
T Consensus       176 GFl~~Yts~~~~~~f~k~SareqVl~eV~~L~~~Yp~e~~sItvTGHSLGGALAtLaA~dl~~~~~n~~~~~~~~~~~~V  255 (415)
T PLN02324        176 GWLDIYTASDSRSPYDTTSAQEQVQGELKRLLELYKNEEISITFTGHSLGAVMSVLSAADLVYGKKNKINISLQKKQVPI  255 (415)
T ss_pred             hHHHHhcCcCcccccchhHHHHHHHHHHHHHHHHCCCCCceEEEecCcHHHHHHHHHHHHHHHhcccccccccccCCCce
Confidence            1                 1223467788899999986  6899999999999999999999753            3568


Q ss_pred             eEEEecCCCCCcH-HHHHhcccC-CceEEeeCchhhhhhhhhhhccCCCCCCCccccccccCcccccccC---------C
Q 018701          186 EAYLFNPPFVSAP-IERIKDKRV-KHGIRIAGSVITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVN---------P  254 (351)
Q Consensus       186 ~~ytFg~PrVgn~-~~~~~~~~~-~~~~Rv~~~~ika~~~~~~~~~~~~~~~~~~~f~~~~~W~P~lyVn---------~  254 (351)
                      .+||||+|||||. |++.+++.. .+.+||+|.           .|.+  |..+..  .+.+--++|+|+         +
T Consensus       256 ~v~TFGsPRVGN~~Fa~~~~~~~~~~~~RVvn~-----------~D~V--P~lP~~--~Y~hvG~el~Id~~~Spylk~~  320 (415)
T PLN02324        256 TVFAFGSPRIGDHNFKNLVDSLQPLNILRIVNV-----------PDVA--PHYPLL--LYTEIGEVLEINTLNSTYLKRS  320 (415)
T ss_pred             EEEEecCCCcCCHHHHHHHHhcCCcceEEEEeC-----------CCcC--CcCCCc--ccccCceEEEEcCCCCcccCCC
Confidence            8999999999995 788876544 568999997           1222  121111  344444455554         5


Q ss_pred             CCcccccccchhhhhH
Q 018701          255 ADDICSEYIGYFEHRK  270 (351)
Q Consensus       255 ~D~ic~~yi~yf~~r~  270 (351)
                      +|+.|++-++-|.|--
T Consensus       321 ~~~~~~H~Le~ylH~v  336 (415)
T PLN02324        321 LNFRNYHNLEAYLHGV  336 (415)
T ss_pred             CCccccchHHHHHhhh
Confidence            6788998888887754

>PLN02454 triacylglycerol lipase	Back alignment and domain information

>PLN02310 triacylglycerol lipase	Back alignment and domain information

>PLN02408 phospholipase A1	Back alignment and domain information

>PLN02802 triacylglycerol lipase	Back alignment and domain information

>PLN02761 lipase class 3 family protein	Back alignment and domain information

>PLN02719 triacylglycerol lipase	Back alignment and domain information

>PLN02571 triacylglycerol lipase	Back alignment and domain information

>PLN02753 triacylglycerol lipase	Back alignment and domain information

>PLN03037 lipase class 3 family protein; Provisional	Back alignment and domain information

>KOG4569 consensus Predicted lipase [Lipid transport and metabolism]	Back alignment and domain information

>PLN02162 triacylglycerol lipase	Back alignment and domain information

>PLN02934 triacylglycerol lipase	Back alignment and domain information

>cd00519 Lipase_3 Lipase (class 3)	Back alignment and domain information

>PLN00413 triacylglycerol lipase	Back alignment and domain information

>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides []	Back alignment and domain information

>PLN02847 triacylglycerol lipase	Back alignment and domain information

>cd00741 Lipase Lipase	Back alignment and domain information

>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function	Back alignment and domain information

>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism]	Back alignment and domain information

>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism]	Back alignment and domain information

>COG3675 Predicted lipase [Lipid metabolism]	Back alignment and domain information

>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT)	Back alignment and domain information

>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []	Back alignment and domain information

>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases	Back alignment and domain information

>PRK11071 esterase YqiA; Provisional	Back alignment and domain information

>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO	Back alignment and domain information

>PRK10985 putative hydrolase; Provisional	Back alignment and domain information

>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase	Back alignment and domain information

>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A	Back alignment and domain information

>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional	Back alignment and domain information

>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase	Back alignment and domain information

>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>PLN02965 Probable pheophorbidase	Back alignment and domain information

>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids []	Back alignment and domain information

>PLN02733 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>PHA02857 monoglyceride lipase; Provisional	Back alignment and domain information

>PLN02824 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PRK10673 acyl-CoA esterase; Provisional	Back alignment and domain information

>COG2267 PldB Lysophospholipase [Lipid metabolism]	Back alignment and domain information

>TIGR03611 RutD pyrimidine utilization protein D	Back alignment and domain information

>PRK10749 lysophospholipase L2; Provisional	Back alignment and domain information

>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase	Back alignment and domain information

>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes	Back alignment and domain information

>COG3675 Predicted lipase [Lipid metabolism]	Back alignment and domain information

>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PRK00870 haloalkane dehalogenase; Provisional	Back alignment and domain information

>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily	Back alignment and domain information

>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein	Back alignment and domain information

>PLN02511 hydrolase	Back alignment and domain information

>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase	Back alignment and domain information

>PRK04940 hypothetical protein; Provisional	Back alignment and domain information

>PRK03592 haloalkane dehalogenase; Provisional	Back alignment and domain information

>PRK03204 haloalkane dehalogenase; Provisional	Back alignment and domain information

>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A)	Back alignment and domain information

>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PLN02211 methyl indole-3-acetate methyltransferase	Back alignment and domain information

>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH	Back alignment and domain information

>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit	Back alignment and domain information

>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3	Back alignment and domain information

>PLN02298 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02385 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PRK13604 luxD acyl transferase; Provisional	Back alignment and domain information

>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A	Back alignment and domain information

>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional	Back alignment and domain information

>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily	Back alignment and domain information

>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2	Back alignment and domain information

>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase	Back alignment and domain information

>PRK10349 carboxylesterase BioH; Provisional	Back alignment and domain information

>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I	Back alignment and domain information

>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases	Back alignment and domain information

>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated	Back alignment and domain information

>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification	Back alignment and domain information

>PLN02652 hydrolase; alpha/beta fold family protein	Back alignment and domain information

>PLN02894 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PLN02578 hydrolase	Back alignment and domain information

>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins	Back alignment and domain information

>TIGR02821 fghA_ester_D S-formylglutathione hydrolase	Back alignment and domain information

>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold	Back alignment and domain information

>TIGR01840 esterase_phb esterase, PHB depolymerase family	Back alignment and domain information

>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria	Back alignment and domain information

>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated	Back alignment and domain information

>PLN02679 hydrolase, alpha/beta fold family protein	Back alignment and domain information

>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function	Back alignment and domain information

>PRK08775 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK10566 esterase; Provisional	Back alignment and domain information

>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>smart00824 PKS_TE Thioesterase	Back alignment and domain information

>TIGR03230 lipo_lipase lipoprotein lipase	Back alignment and domain information

>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional	Back alignment and domain information

>PRK00175 metX homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PRK06489 hypothetical protein; Provisional	Back alignment and domain information

>PLN02442 S-formylglutathione hydrolase	Back alignment and domain information

>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PRK10162 acetyl esterase; Provisional	Back alignment and domain information

>COG3150 Predicted esterase [General function prediction only]	Back alignment and domain information

>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function	Back alignment and domain information

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism]	Back alignment and domain information

>PLN00021 chlorophyllase	Back alignment and domain information

>PRK11460 putative hydrolase; Provisional	Back alignment and domain information

>PRK07581 hypothetical protein; Validated	Back alignment and domain information

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only]	Back alignment and domain information

>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PRK06765 homoserine O-acetyltransferase; Provisional	Back alignment and domain information

>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE)	Back alignment and domain information

>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like	Back alignment and domain information

>PF10503 Esterase_phd: Esterase PHB depolymerase	Back alignment and domain information

>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins	Back alignment and domain information

>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only]	Back alignment and domain information

>PTZ00472 serine carboxypeptidase (CBP1); Provisional	Back alignment and domain information

>PLN02517 phosphatidylcholine-sterol O-acyltransferase	Back alignment and domain information

>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only]	Back alignment and domain information

>PRK05077 frsA fermentation/respiration switch protein; Reviewed	Back alignment and domain information

>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins	Back alignment and domain information

>PLN03084 alpha/beta hydrolase fold protein; Provisional	Back alignment and domain information

>COG0657 Aes Esterase/lipase [Lipid metabolism]	Back alignment and domain information

>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding	Back alignment and domain information

>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []	Back alignment and domain information

>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A	Back alignment and domain information

>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II	Back alignment and domain information

>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02872 triacylglycerol lipase	Back alignment and domain information

>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		351
1tib_A		269	Lipase; hydrolase(carboxylic esterase); 1.84A {The	7e-10
3ngm_A		319	Extracellular lipase; secret lipase, hydrolase; 2.	5e-08
1tia_A		279	Lipase; hydrolase(carboxylic esterase); 2.10A {Pen	3e-07
1uwc_A		261	Feruloyl esterase A; hydrolase, serine esterase, x	5e-07
1lgy_A		269	Lipase, triacylglycerol lipase; hydrolase (carboxy	3e-06
1tgl_A		269	Triacyl-glycerol acylhydrolase; carboxylic esteras	9e-06
3g7n_A		258	Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A	1e-05
3uue_A		279	LIP1, secretory lipase (family 3); LID-domain, hyd	2e-05
3o0d_A		301	YALI0A20350P, triacylglycerol lipase; alpha/beta-h	2e-05
2ory_A		346	Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph	5e-05

>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269	Back alignment and structure

 Score = 58.0 bits (140), Expect = 7e-10
 Identities = 30/173 (17%), Positives = 56/173 (32%), Gaps = 35/173 (20%)

Query: 58  PWWEFFQFKLLHQLKDDADFSIFGAIYEFKPPPSHSHSDLSKDGIPRYVIAFRGTLTKPD 117
           P  E      L+  +D     + G +        +++  +        V++FRG+ +  +
Sbjct: 42  PEVEKADATFLYSFEDSGVGDVTGFLAL-----DNTNKLI--------VLSFRGSRSIEN 88

Query: 118 SFSRDLELD------------VHLIRNGLHLTSRFEIAIQAVRNMVASVGSSNVWLAGHS 165
               +L  D             H        +    +  Q V + V       V   GHS
Sbjct: 89  WIG-NLNFDLKEINDICSGCRGHDGFTSSWRSVADTL-RQKVEDAVREHPDYRVVFTGHS 146

Query: 166 LGSAMAMLAGKTVAKTGVFLEAYLF------NPPFVSAPIERIKDK--RVKHG 210
           LG A+A +AG  +   G  ++ + +      N  F      +      R+ H 
Sbjct: 147 LGGALATVAGADLRGNGYDIDVFSYGAPRVGNRAFAEFLTVQTGGTLYRITHT 199

PyMOL of 1tib

>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319	Back alignment and structure

>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279	Back alignment and structure

>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261	Back alignment and structure

>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269	Back alignment and structure

>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269	Back alignment and structure

>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258	Back alignment and structure

>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279	Back alignment and structure

>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301	Back alignment and structure

>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		351
2yij_A		419	Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid	99.88
3g7n_A		258	Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A	99.92
3ngm_A		319	Extracellular lipase; secret lipase, hydrolase; 2.	99.9
3uue_A		279	LIP1, secretory lipase (family 3); LID-domain, hyd	99.89
3o0d_A		301	YALI0A20350P, triacylglycerol lipase; alpha/beta-h	99.88
1tia_A		279	Lipase; hydrolase(carboxylic esterase); 2.10A {Pen	99.87
1uwc_A		261	Feruloyl esterase A; hydrolase, serine esterase, x	99.87
1lgy_A		269	Lipase, triacylglycerol lipase; hydrolase (carboxy	99.85
1tib_A		269	Lipase; hydrolase(carboxylic esterase); 1.84A {The	99.84
1tgl_A		269	Triacyl-glycerol acylhydrolase; carboxylic esteras	99.76
2ory_A		346	Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph	99.72
1isp_A		181	Lipase; alpha/beta hydrolase fold, hydrolase; 1.30	96.8
4fle_A		202	Esterase; structural genomics, PSI-biology, northe	96.69
2qub_A		615	Extracellular lipase; beta roll, alpha/beta hydrol	96.59
3llc_A		270	Putative hydrolase; structural genomics, joint cen	96.54
3ds8_A		254	LIN2722 protein; unkonwn function, structural geno	96.49
3h04_A		275	Uncharacterized protein; protein with unknown func	96.34
2xmz_A		269	Hydrolase, alpha/beta hydrolase fold family; menaq	96.26
4g9e_A		279	AHL-lactonase, alpha/beta hydrolase fold protein;	96.23
3ils_A		265	PKS, aflatoxin biosynthesis polyketide synthase; A	96.17
3bf7_A		255	Esterase YBFF; thioesterase, helical CAP, hydrolas	96.13
1ex9_A		285	Lactonizing lipase; alpha-beta hydrolase fold, pho	96.11
3fle_A		249	SE_1780 protein; structural genomics, APC61035.1,	96.11
3fla_A		267	RIFR; alpha-beta hydrolase thioesterase, hydrolase	96.09
3qmv_A		280	Thioesterase, REDJ; alpha/beta hydrolase fold, hyd	96.08
3lp5_A		250	Putative cell surface hydrolase; structural genom	96.08
2dst_A		131	Hypothetical protein TTHA1544; conserved hypotheti	96.06
1wom_A		271	RSBQ, sigma factor SIGB regulation protein RSBQ; a	96.06
1azw_A		313	Proline iminopeptidase; aminopeptidase, serine pro	96.05
2fuk_A		220	XC6422 protein; A/B hydrolase, structural genomics	96.03
3oos_A		278	Alpha/beta hydrolase family protein; APC67239.0, p	96.02
1tca_A		317	Lipase; hydrolase(carboxylic esterase); HET: NAG;	96.01
3d7r_A		326	Esterase; alpha/beta fold, hydrolase; 2.01A {Staph	96.01
3ibt_A		264	1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO,	95.99
1iup_A		282	META-cleavage product hydrolase; aromatic compound	95.98
3l80_A		292	Putative uncharacterized protein SMU.1393C; alpha/	95.97
1wm1_A		317	Proline iminopeptidase; complex with inhibitor, hy	95.96
1mtz_A		293	Proline iminopeptidase; alpha-beta hydrolase, CAP	95.95
3icv_A		316	Lipase B, CALB; circular permutation, cleavage on	95.94
2x5x_A		342	PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE	95.94
3qvm_A		282	OLEI00960; structural genomics, PSI-biology, midwe	95.94
1hkh_A		279	Gamma lactamase; hydrolase, alpha/beta hydrolase,	95.93
3bwx_A		285	Alpha/beta hydrolase; YP_496220.1, joint center fo	95.93
2xua_A		266	PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate	95.93
2qs9_A		194	Retinoblastoma-binding protein 9; B5T overexpresse	95.91
2ocg_A		254	Valacyclovir hydrolase; alpha beta hydrolase fold;	95.91
1a8q_A		274	Bromoperoxidase A1; haloperoxidase, oxidoreductase	95.9
3v48_A		268	Aminohydrolase, putative aminoacrylate hydrolase R	95.88
1u2e_A		289	2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase	95.88
2wfl_A		264	Polyneuridine-aldehyde esterase; alkaloid metaboli	95.87
2yys_A		286	Proline iminopeptidase-related protein; TTHA1809,	95.87
2puj_A		286	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola;	95.87
3fsg_A		272	Alpha/beta superfamily hydrolase; PF00561, MCSG, P	95.86
1brt_A		277	Bromoperoxidase A2; haloperoxidase, oxidoreductase	95.85
1a8s_A		273	Chloroperoxidase F; haloperoxidase, oxidoreductase	95.84
1c4x_A		285	BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di	95.84
3bdv_A		191	Uncharacterized protein DUF1234; DUF1234 family pr	95.82
1zoi_A		276	Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo	95.82
1a88_A		275	Chloroperoxidase L; haloperoxidase, oxidoreductase	95.81
1q0r_A		298	RDMC, aclacinomycin methylesterase; anthracycline,	95.8
3u1t_A		309	DMMA haloalkane dehalogenase; alpha/beta-hydrolase	95.78
2wue_A		291	2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas	95.78
2cjp_A		328	Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu	95.77
1ys1_X		320	Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h	95.77
3r40_A		306	Fluoroacetate dehalogenase; FACD, defluorinase, al	95.76
3c6x_A		257	Hydroxynitrilase; atomic resolution, hydroxynitril	95.75
3om8_A		266	Probable hydrolase; structural genomics, PSI-2, pr	95.75
1ehy_A		294	Protein (soluble epoxide hydrolase); alpha/beta hy	95.75
1r3d_A		264	Conserved hypothetical protein VC1974; structural	95.73
1xkl_A		273	SABP2, salicylic acid-binding protein 2; alpha-bet	95.72
2wj6_A		276	1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid	95.72
3qit_A		286	CURM TE, polyketide synthase; thioesterase, alpha/	95.7
1uxo_A		192	YDEN protein; hydrolase, A/B hydrolase, esterase,	95.7
3sty_A		267	Methylketone synthase 1; alpha/beta hydrolase, dec	95.67
3bdi_A		207	Uncharacterized protein TA0194; NP_393672.1, predi	95.66
3g9x_A		299	Haloalkane dehalogenase; alpha/beta hydrolase, hel	95.66
4dnp_A		269	DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu	95.64
1vkh_A		273	Putative serine hydrolase; structural genomics, jo	95.64
3r0v_A		262	Alpha/beta hydrolase fold protein; structural geno	95.63
2psd_A		318	Renilla-luciferin 2-monooxygenase; alpha/beta-hydr	95.62
3trd_A		208	Alpha/beta hydrolase; cellular processes; 1.50A {C	95.61
3dqz_A		258	Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl	95.59
3dkr_A		251	Esterase D; alpha beta hydrolase, mechanism, catal	95.58
3hss_A		293	Putative bromoperoxidase; alpha beta hydrolase, ox	95.57
3rm3_A		270	MGLP, thermostable monoacylglycerol lipase; alpha/	95.55
3pe6_A		303	Monoglyceride lipase; alpha-beta hydrolase fold, 2	95.54
3c5v_A		316	PME-1, protein phosphatase methylesterase 1; demet	95.54
3ia2_A		271	Arylesterase; alpha-beta hydrolase fold, transitio	95.53
1k8q_A		377	Triacylglycerol lipase, gastric; APHA beta hydrola	95.52
3afi_E		316	Haloalkane dehalogenase; A/B-hydrolase, hydrolase;	95.51
1j1i_A		296	META cleavage compound hydrolase; carbazole degrad	95.5
2xt0_A		297	Haloalkane dehalogenase; hydrolase, alpha-beta hyd	95.5
1tqh_A		247	Carboxylesterase precursor; tetrahedral intermedia	95.49
3fob_A		281	Bromoperoxidase; structural genomics, IDP00046, ba	95.49
3k6k_A		322	Esterase/lipase; alpha/beta hydrolase fold; 2.20A	95.49
4f0j_A		315	Probable hydrolytic enzyme; alpha/beta hydrolase f	95.48
1qoz_A		207	AXE, acetyl xylan esterase; hydrolase, xylan degra	95.44
3kda_A		301	CFTR inhibitory factor (CIF); alpha/beta hydrolase	95.42
2qvb_A		297	Haloalkane dehalogenase 3; RV2579, alpha-beta hydr	95.41
2qmq_A		286	Protein NDRG2, protein NDR2; alpha/beta-hydrolases	95.4
2qjw_A		176	Uncharacterized protein XCC1541; putative hydrolas	95.39
3u0v_A		239	Lysophospholipase-like protein 1; alpha, beta hydr	95.33
2r8b_A		251	AGR_C_4453P, uncharacterized protein ATU2452; APC6	95.33
1g66_A		207	Acetyl xylan esterase II; serine hydrolase, acetyl	95.33
1pja_A		302	Palmitoyl-protein thioesterase 2 precursor; hydrol	95.3
3nwo_A		330	PIP, proline iminopeptidase; structural genomics,	95.29
2h1i_A		226	Carboxylesterase; structural genomics, PSI-2, prot	95.29
3e0x_A		245	Lipase-esterase related protein; APC60309, clostri	95.27
1mj5_A		302	1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase;	95.27
3lcr_A		319	Tautomycetin biosynthetic PKS; alpha-beta hydrolas	95.2
3tjm_A		283	Fatty acid synthase; thioesterase domain, fatty ac	95.18
1auo_A		218	Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl	95.18
2r11_A		306	Carboxylesterase NP; 2632844, putative hydrolase,	95.15
1ycd_A		243	Hypothetical 27.3 kDa protein in AAP1-SMF2 interge	95.08
2pl5_A		366	Homoserine O-acetyltransferase; alpha/beta hydrola	95.07
3i1i_A		377	Homoserine O-acetyltransferase; structural genomic	95.06
3hju_A		342	Monoglyceride lipase; alpha/beta hydrolase, hydrol	95.03
1kez_A		300	Erythronolide synthase; polyketide synthase, modul	94.98
2b61_A		377	Homoserine O-acetyltransferase; acyl-enzyme, aspar	94.98
3kxp_A		314	Alpha-(N-acetylaminomethylene)succinic acid hydrol	94.94
3b5e_A		223	MLL8374 protein; NP_108484.1, carboxylesterase, st	94.93
3tej_A		329	Enterobactin synthase component F; nonribosomal pe	94.92
2q0x_A		335	Protein DUF1749, uncharacterized protein; alpha/be	94.9
2z8x_A		617	Lipase; beta roll, calcium binding protein, RTX pr	94.89
3fak_A		322	Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc	94.88
3pfb_A		270	Cinnamoyl esterase; alpha/beta hydrolase fold, hyd	94.83
3p2m_A		330	Possible hydrolase; alpha/beta hydrolase superfami	94.81
2cb9_A		244	Fengycin synthetase; thioesterase, non-ribosomal p	94.8
1ufo_A		238	Hypothetical protein TT1662; alpha-beta fold, hydr	94.72
3qyj_A		291	ALR0039 protein; alpha/beta fold, hydrolase; 1.78A	94.71
2i3d_A		249	AGR_C_3351P, hypothetical protein ATU1826; structu	94.68
1jmk_C		230	SRFTE, surfactin synthetase; thioesterase, non-rib	94.68
3og9_A		209	Protein YAHD A copper inducible hydrolase; alpha/b	94.63
1b6g_A		310	Haloalkane dehalogenase; hydrolase, alpha/beta-hyd	94.61
1m33_A		258	BIOH protein; alpha-betta-alpha sandwich, structur	94.61
3cn9_A		226	Carboxylesterase; alpha/beta hydrolase fold super-	94.59
1fj2_A		232	Protein (acyl protein thioesterase 1); alpha/beta	94.56
2zsh_A		351	Probable gibberellin receptor GID1L1; plant hormon	94.55
2rau_A		354	Putative esterase; NP_343859.1, putative lipase, s	94.48
1zi8_A		236	Carboxymethylenebutenolidase; alpha and beta prote	94.45
1jkm_A		361	Brefeldin A esterase; serine hydrolase, degradatio	94.45
1imj_A		210	CIB, CCG1-interacting factor B; alpha/beta hydrola	94.42
2zyr_A		484	Lipase, putative; fatty acid, hydrolase; HET: 1PE;	94.41
2wtm_A		251	EST1E; hydrolase; 1.60A {Clostridium proteoclastic	94.41
1tht_A		305	Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.	94.39
4e15_A		303	Kynurenine formamidase; alpha/beta hydrolase fold,	94.29
4fbl_A		281	LIPS lipolytic enzyme; thermostable, structural ge	94.29
2pbl_A		262	Putative esterase/lipase/thioesterase; alpha/beta-	94.23
2c7b_A		311	Carboxylesterase, ESTE1; carboxyesterase, thermoph	94.22
2qru_A		274	Uncharacterized protein; alpha/beta-hydrolase, str	94.16
2e3j_A		356	Epoxide hydrolase EPHB; epoxide hydrolase B, struc	94.16
2hih_A		431	Lipase 46 kDa form; A1 phospholipase, phospholipid	94.15
2dsn_A		387	Thermostable lipase; T1 lipase, hydrolase; 1.50A {	94.14
1ei9_A		279	Palmitoyl protein thioesterase 1; alpha/beta hydro	94.1
3i28_A		555	Epoxide hydrolase 2; aromatic hydrocarbons catabol	94.1
2hfk_A		319	Pikromycin, type I polyketide synthase pikaiv; alp	94.01
3b12_A		304	Fluoroacetate dehalogenase; dehalogease, hydrolase	93.05
3ain_A		323	303AA long hypothetical esterase; carboxylesterase	93.97
3bxp_A		277	Putative lipase/esterase; putative carboxylesteras	93.97
2uz0_A		263	Esterase, tributyrin esterase; alpha/beta hydrolas	93.95
1jji_A		311	Carboxylesterase; alpha-beta hydrolase fold, hydro	93.93
2o2g_A		223	Dienelactone hydrolase; YP_324580.1, structural ge	93.9
2vat_A		444	Acetyl-COA--deacetylcephalosporin C acetyltransfer	93.82
2wir_A		313	Pesta, alpha/beta hydrolase fold-3 domain protein;	93.76
3d0k_A		304	Putative poly(3-hydroxybutyrate) depolymerase LPQ;	93.73
2k2q_B		242	Surfactin synthetase thioesterase subunit; A/B-hyd	93.73
3ga7_A		326	Acetyl esterase; phosphoserine, IDP00896, hydrolas	93.63
1w52_X		452	Pancreatic lipase related protein 2; detergent, cl	93.63
4i19_A		388	Epoxide hydrolase; structural genomics, PSI-biolog	93.57
1rp1_A		450	Pancreatic lipase related protein 1; hydrolase, li	93.53
1gpl_A		432	RP2 lipase; serine esterase, hydrolase, lipid degr	93.51
3e4d_A		278	Esterase D; S-formylglutathione hydrolase, hydrola	93.49
3vdx_A		456	Designed 16NM tetrahedral protein CAGE containing	93.47
3hc7_A		254	Gene 12 protein, GP12; alpha/beta sandwich, cell a	93.45
3i6y_A		280	Esterase APC40077; lipase, structural genomics, PS	93.41
3bjr_A		283	Putative carboxylesterase; structural genomics, jo	93.4
3ebl_A		365	Gibberellin receptor GID1; alpha/beta hydrolase, l	93.38
1hpl_A		449	Lipase; hydrolase(carboxylic esterase); 2.30A {Equ	93.36
4b6g_A		283	Putative esterase; hydrolase, formaldehyde detoxif	93.34
1lzl_A		323	Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod	93.29
2o7r_A		338	CXE carboxylesterase; alpha/beta hydrolase; 1.40A	93.26
1l7a_A		318	Cephalosporin C deacetylase; structural genomics,	93.26
3h2g_A		397	Esterase; xanthomonas oryzae PV. oryzae, cell WALL	93.16
1dqz_A		280	85C, protein (antigen 85-C); fibronectin, structur	93.13
3f67_A		241	Putative dienelactone hydrolase; alpha-beta-alpha	93.02
2y6u_A		398	Peroxisomal membrane protein LPX1; hydrolase, puta	93.01
3doh_A		380	Esterase; alpha-beta hydrolase, beta sheet; 2.60A	92.76
1vlq_A		337	Acetyl xylan esterase; TM0077, structural genomics	92.76
3hxk_A		276	Sugar hydrolase; alpha-beta protein., structural g	92.65
3fcx_A		282	FGH, esterase D, S-formylglutathione hydrolase; re	92.57
1bu8_A		452	Protein (pancreatic lipase related protein 2); hyd	92.55
2hm7_A		310	Carboxylesterase; alpha/beta hydrolase fold, hydro	92.5
1jfr_A		262	Lipase; serine hydrolase; 1.90A {Streptomyces exfo	92.39
1r88_A		280	MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP	92.31
3g02_A		408	Epoxide hydrolase; alpha/beta hydrolase fold, enan	92.29
3ls2_A		280	S-formylglutathione hydrolase; psychrophilic organ	92.28
2fx5_A		258	Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse	92.18
1sfr_A		304	Antigen 85-A; alpha/beta hydrolase, structural gen	92.02
3qpa_A		197	Cutinase; alpha-beta hydrolase fold, esterase, hyd	91.97
2px6_A		316	Thioesterase domain; thioesaterse domain, orlistat	91.96
2czq_A		205	Cutinase-like protein; alpha/beta hydrolase fold,	91.96
1qlw_A		328	Esterase; anisotropic refinement, atomic resolutio	91.84
3ksr_A		290	Putative serine hydrolase; catalytic triad, struct	91.83
3qh4_A		317	Esterase LIPW; structural genomics, ssgcid, seattl	91.79
4h0c_A		210	Phospholipase/carboxylesterase; PSI-biology, midwe	91.25
1jjf_A		268	Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x	91.09
3fcy_A		346	Xylan esterase 1; alpha/beta hydrolase, carbohydra	90.91
3k2i_A		422	Acyl-coenzyme A thioesterase 4; alpha/beta hydrola	90.78
3aja_A		302	Putative uncharacterized protein; alpha-beta hydro	90.62
3n2z_B		446	Lysosomal Pro-X carboxypeptidase; alpha/beta hydro	90.51
4ezi_A		377	Uncharacterized protein; alpha-beta hydrolases fol	90.18
2hdw_A		367	Hypothetical protein PA2218; alpha/beta hydrolase	89.76
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	89.58
3hlk_A		446	Acyl-coenzyme A thioesterase 2, mitochondrial; alp	89.52
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	89.46
3fnb_A		405	Acylaminoacyl peptidase SMU_737; alpha-beta-alpha	89.1
2jbw_A		386	Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine	88.75
3mve_A		415	FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/	88.65
3vis_A		306	Esterase; alpha/beta-hydrolase fold, polyethylene	88.51
3dcn_A		201	Cutinase, cutin hydrolase; catalytic triad, secret	88.22
4fhz_A		285	Phospholipase/carboxylesterase; alpha/beta hydrola	88.04
3g8y_A		391	SUSD/RAGB-associated esterase-like protein; struct	87.76
3qpd_A		187	Cutinase 1; alpha-beta hydrolase fold, esterase, h	87.52
2qm0_A		275	BES; alpha-beta structure, structural genomics, PS	86.52
3d59_A		383	Platelet-activating factor acetylhydrolase; secret	85.86
3nuz_A		398	Putative acetyl xylan esterase; structural genomic	85.55
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	85.27
3guu_A		462	Lipase A; protein structure, hydrolase; HET: 1PE;	84.79
1gkl_A		297	Endo-1,4-beta-xylanase Y; hydrolase, esterase fami	84.66
2gzs_A		278	IROE protein; enterobactin, salmochelin, DFP, hydr	83.59
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	83.54
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	82.48
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	82.36
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	82.2
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	81.79
1whs_A		255	Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T	81.76
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	81.61
3pic_A		375	CIP2; alpha/beta hydrolase fold, glucuronoyl ester	81.35
2d81_A		318	PHB depolymerase; alpha/beta hydrolase fold, circu	81.34
4f21_A		246	Carboxylesterase/phospholipase family protein; str	81.22
2ogt_A		498	Thermostable carboxylesterase EST50; alpha/beta hy	81.21
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	81.16
4ao6_A		259	Esterase; hydrolase, thermo label; 1.60A {Unidenti	80.55

>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana}	Back alignment and structure

Probab=99.88  E-value=1.6e-27  Score=237.60  Aligned_cols=229  Identities=15%  Similarity=0.196  Sum_probs=148.5

Q ss_pred             CccccHHHH--HHHHHhhhhhh-hhhhh-----hhcccccCCC-CCc---ccc-cceeeeeeecCCCcceeeeEeeeCC-
Q 018701           23 NVHHRRSVA--ACLVQGVYILE-RDRQL-----QRHESQALAP-PWW---EFF-QFKLLHQLKDDADFSIFGAIYEFKP-   88 (351)
Q Consensus        23 ~~~~rr~v~--a~Lvq~vY~~~-~dr~~-----~r~~~~~lap-~ww---~~f-~f~l~~~l~d~~d~si~gav~e~~~-   88 (351)
                      |+++||.||  ++|||++|+.. .|+.+     +|++...+-. .--   .++ .|++++.||++++-.+..++..... 
T Consensus        40 d~~lr~~iirYGe~~qa~yd~f~~~~~s~~~g~~~y~~~~~~~~~~~~~~~~~~~Y~vt~~lyat~~~~~p~~~~~~~~~  119 (419)
T 2yij_A           40 DQDLREYIIHYGEMAQAGYDTFNINTESQFAGASIYSRKDFFAKVGLEIAHPYTKYKVTKFIYATSDIHVPESFLLFPIS  119 (419)
Confidence            789999999  88999999994 34332     4444321100 000   224 7999999999876544444322111 


Q ss_pred             -CCCCCCCCC------------CCCCCCeEEEEEcCCCCCccccccccccccccc---------ccccccc--h------
Q 018701           89 -PPSHSHSDL------------SKDGIPRYVIAFRGTLTKPDSFSRDLELDVHLI---------RNGLHLT--S------  138 (351)
Q Consensus        89 -~~~~~~~~~------------~~~~~~~iVIAfRGT~~~~d~~~~Dl~~dl~~~---------~~~lh~~--~------  138 (351)
                       ..+..+.++            ...+++.||||||||.+..||++ |+.+...-.         .-.+|..  .      
T Consensus       120 ~~~w~~~s~~~GYVAv~~d~~~~~lGrk~IVVafRGT~s~~DWlt-DL~~~~~~~~~~~g~~~~~~kVH~GF~~ay~~~~  198 (419)
T 2yij_A          120 REGWSKESNWMGYVAVTDDQGTALLGRRDIVVSWRGSVQPLEWVE-DFEFGLVNAIKIFGERNDQVQIHQGWYSIYMSQD  198 (419)
Confidence             111111111            01246799999999999999998 887744311         1123331  1      


Q ss_pred             ---------HHHHHHHHHHHHHHHhCC--ccEEEeecchhHHHHHHHHHHHHhcC-----------CceeEEEecCCCCC
Q 018701          139 ---------RFEIAIQAVRNMVASVGS--SNVWLAGHSLGSAMAMLAGKTVAKTG-----------VFLEAYLFNPPFVS  196 (351)
Q Consensus       139 ---------~f~~a~~~v~~~~~~~~~--~~I~itGHSLGGALA~L~a~~l~~~g-----------~~v~~ytFg~PrVg  196 (351)
                               ....++++|++++++||+  ++|+|||||||||||+|+|.+|...+           .++.+||||+||||
T Consensus       199 ~~~~f~~~s~r~~Vl~~l~~ll~~yp~~~~~I~vTGHSLGGALA~L~A~~L~~~~~~~~~~~~~~~~~v~vyTFGsPRVG  278 (419)
T 2yij_A          199 ERSPFTKTNARDQVLREVGRLLEKYKDEEVSITICGHSLGAALATLSATDIVANGYNRPKSRPDKSCPVTAFVFASPRVG  278 (419)
Confidence                     123456778888899987  89999999999999999999998643           36889999999999


Q ss_pred             cH-HHHHhcccC-CceEEeeCc--hhhhhhhhhhhccCCCCCCCccccccccCcccccccC---------CCCccccccc
Q 018701          197 AP-IERIKDKRV-KHGIRIAGS--VITAGLALAAKINHHNTRLSEDPFLALSAWVPCLFVN---------PADDICSEYI  263 (351)
Q Consensus       197 n~-~~~~~~~~~-~~~~Rv~~~--~ika~~~~~~~~~~~~~~~~~~~f~~~~~W~P~lyVn---------~~D~ic~~yi  263 (351)
                      |. |++.+++.. .+.+||+|.  +|+..+.                 .++.+--.++|++         +++++|++-+
T Consensus       279 n~~Fa~~~~~~~~~~~~RVvn~~DiVP~lPp-----------------~gY~HvG~ev~id~~~spylk~~~~~~~~H~L  341 (419)
T 2yij_A          279 DSDFRKLFSGLEDIRVLRTRNLPDVIPIYPP-----------------IGYSEVGDEFPIDTRKSPYMKSPGNLATFHCL  341 (419)
Confidence            95 677776643 568999986  3333221                 1222323333332         4577888888


Q ss_pred             chhhhh
Q 018701          264 GYFEHR  269 (351)
Q Consensus       264 ~yf~~r  269 (351)
                      +.|.|-
T Consensus       342 e~Ylh~  347 (419)
T 2yij_A          342 EGYLHG  347 (419)
Confidence            877763

PyMOL of 2yij

>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum}	Back alignment and structure

>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae}	Back alignment and structure

>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A*	Back alignment and structure

>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0	Back alignment and structure

>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17	Back alignment and structure

>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A*	Back alignment and structure

>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A	Back alignment and structure

>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A*	Back alignment and structure

>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A	Back alignment and structure

>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP}	Back alignment and structure

>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A	Back alignment and structure

>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp}	Back alignment and structure

>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A	Back alignment and structure

>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis}	Back alignment and structure

>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua}	Back alignment and structure

>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp}	Back alignment and structure

>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus}	Back alignment and structure

>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A	Back alignment and structure

>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus}	Back alignment and structure

>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A	Back alignment and structure

>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18	Back alignment and structure

>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis}	Back alignment and structure

>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A*	Back alignment and structure

>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A*	Back alignment and structure

>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum}	Back alignment and structure

>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39	Back alignment and structure

>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A*	Back alignment and structure

>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7	Back alignment and structure

>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36	Back alignment and structure

>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis}	Back alignment and structure

>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A*	Back alignment and structure

>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp}	Back alignment and structure

>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida}	Back alignment and structure

>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A	Back alignment and structure

>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans}	Back alignment and structure

>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A*	Back alignment and structure

>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A	Back alignment and structure

>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A*	Back alignment and structure

>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A	Back alignment and structure

>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica}	Back alignment and structure

>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A*	Back alignment and structure

>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans}	Back alignment and structure

>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans}	Back alignment and structure

>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens}	Back alignment and structure

>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A	Back alignment and structure

>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12	Back alignment and structure

>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11}	Back alignment and structure

>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli}	Back alignment and structure

>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A*	Back alignment and structure

>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus}	Back alignment and structure

>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A	Back alignment and structure

>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni}	Back alignment and structure

>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A	Back alignment and structure

>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12	Back alignment and structure

>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10	Back alignment and structure

>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043}	Back alignment and structure

>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A	Back alignment and structure

>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12	Back alignment and structure

>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A*	Back alignment and structure

>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified}	Back alignment and structure

>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A	Back alignment and structure

>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A*	Back alignment and structure

>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E	Back alignment and structure

>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A	Back alignment and structure

>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ...	Back alignment and structure

>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0	Back alignment and structure

>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11	Back alignment and structure

>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35	Back alignment and structure

>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A*	Back alignment and structure

>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A*	Back alignment and structure

>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L}	Back alignment and structure

>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31	Back alignment and structure

>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A*	Back alignment and structure

>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A	Back alignment and structure

>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A	Back alignment and structure

>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32	Back alignment and structure

>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus}	Back alignment and structure

>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A	Back alignment and structure

>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii}	Back alignment and structure

>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0	Back alignment and structure

>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A	Back alignment and structure

>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A	Back alignment and structure

>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A	Back alignment and structure

>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A*	Back alignment and structure

>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P	Back alignment and structure

>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A	Back alignment and structure

>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A*	Back alignment and structure

>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A*	Back alignment and structure

>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10	Back alignment and structure

>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica}	Back alignment and structure

>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A	Back alignment and structure

>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0	Back alignment and structure

>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A	Back alignment and structure

>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa}	Back alignment and structure

>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30	Back alignment and structure

>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A	Back alignment and structure

>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A	Back alignment and structure

>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A	Back alignment and structure

>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}	Back alignment and structure

>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens}	Back alignment and structure

>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14	Back alignment and structure

>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A*	Back alignment and structure

>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13	Back alignment and structure

>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis}	Back alignment and structure

>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14	Back alignment and structure

>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum}	Back alignment and structure

>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A	Back alignment and structure

>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP}	Back alignment and structure

>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A	Back alignment and structure

>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A*	Back alignment and structure

>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis}	Back alignment and structure

>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40	Back alignment and structure

>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str}	Back alignment and structure

>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens}	Back alignment and structure

>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A	Back alignment and structure

>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40	Back alignment and structure

>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti}	Back alignment and structure

>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14	Back alignment and structure

>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A	Back alignment and structure

>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei}	Back alignment and structure

>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A	Back alignment and structure

>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A	Back alignment and structure

>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A*	Back alignment and structure

>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis}	Back alignment and structure

>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A*	Back alignment and structure

>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27	Back alignment and structure

>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP}	Back alignment and structure

>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36	Back alignment and structure

>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22	Back alignment and structure

>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0	Back alignment and structure

>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A	Back alignment and structure

>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26	Back alignment and structure

>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A*	Back alignment and structure

>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14	Back alignment and structure

>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A*	Back alignment and structure

>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2}	Back alignment and structure

>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A*	Back alignment and structure

>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2	Back alignment and structure

>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23	Back alignment and structure

>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A*	Back alignment and structure

>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A*	Back alignment and structure

>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13	Back alignment and structure

>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A	Back alignment and structure

>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A	Back alignment and structure

>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2	Back alignment and structure

>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon}	Back alignment and structure

>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis}	Back alignment and structure

>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A*	Back alignment and structure

>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus}	Back alignment and structure

>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A	Back alignment and structure

>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A	Back alignment and structure

>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A*	Back alignment and structure

>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A	Back alignment and structure

>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A	Back alignment and structure

>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A	Back alignment and structure

>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A*	Back alignment and structure

>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae}	Back alignment and structure

>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2	Back alignment and structure

>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis}	Back alignment and structure

>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A*	Back alignment and structure

>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822}	Back alignment and structure

>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A	Back alignment and structure

>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium}	Back alignment and structure

>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus}	Back alignment and structure

>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp}	Back alignment and structure

>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A	Back alignment and structure

>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A	Back alignment and structure

>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0	Back alignment and structure

>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A	Back alignment and structure

>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29}	Back alignment and structure

>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A	Back alignment and structure

>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A*	Back alignment and structure

>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19	Back alignment and structure

>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58}	Back alignment and structure

>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A	Back alignment and structure

>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A	Back alignment and structure

>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B*	Back alignment and structure

>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A	Back alignment and structure

>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A*	Back alignment and structure

>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A*	Back alignment and structure

>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A	Back alignment and structure

>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A*	Back alignment and structure

>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp}	Back alignment and structure

>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0	Back alignment and structure

>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A*	Back alignment and structure

>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A	Back alignment and structure

>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16	Back alignment and structure

>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A*	Back alignment and structure

>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0	Back alignment and structure

>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina}	Back alignment and structure

>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3	Back alignment and structure

>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ...	Back alignment and structure

>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens}	Back alignment and structure

>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP}	Back alignment and structure

>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A*	Back alignment and structure

>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV}	Back alignment and structure

>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum}	Back alignment and structure

>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans}	Back alignment and structure

>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A*	Back alignment and structure

>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP}	Back alignment and structure

>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens}	Back alignment and structure

>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis}	Back alignment and structure

>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens}	Back alignment and structure

>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp}	Back alignment and structure

>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans}	Back alignment and structure

>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41	Back alignment and structure

>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A	Back alignment and structure

>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba}	Back alignment and structure

>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A*	Back alignment and structure

>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A*	Back alignment and structure

>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A	Back alignment and structure

>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579}	Back alignment and structure

>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A*	Back alignment and structure

>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A*	Back alignment and structure

>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A*	Back alignment and structure

>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A*	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina}	Back alignment and structure

>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A*	Back alignment and structure

>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp}	Back alignment and structure

>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		351
d1tiba_		269	c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces	3e-05
d1uwca_		261	c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni	2e-04

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]

 Score = 42.6 bits (99), Expect = 3e-05
 Identities = 24/101 (23%), Positives = 41/101 (40%), Gaps = 12/101 (11%)

Query: 106 VIAFRGTLTKPDSFSRDLELDVHLIRNGLH-----------LTSRFEIAIQAVRNMVASV 154
           V++FRG+ +  +    +L  D+  I +                S  +   Q V + V   
Sbjct: 77  VLSFRGSRSIENWIG-NLNFDLKEINDICSGCRGHDGFTSSWRSVADTLRQKVEDAVREH 135

Query: 155 GSSNVWLAGHSLGSAMAMLAGKTVAKTGVFLEAYLFNPPFV 195
               V   GHSLG A+A +AG  +   G  ++ + +  P V
Sbjct: 136 PDYRVVFTGHSLGGALATVAGADLRGNGYDIDVFSYGAPRV 176

PyMOL of d1tiba_

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		351
d1tiba_		269	Triacylglycerol lipase {Thermomyces lanuginosus, f	99.92
d1lgya_		265	Triacylglycerol lipase {Rhizopus niveus [TaxId: 48	99.91
d1tiaa_		271	Triacylglycerol lipase {Penicillium camembertii [T	99.91
d1uwca_		261	Feruloyl esterase A {Aspergillus niger [TaxId: 506	99.9
d3tgla_		265	Triacylglycerol lipase {Rhizomucor miehei [TaxId:	99.9
d1ispa_		179	Lipase A {Bacillus subtilis [TaxId: 1423]}	97.1
d1jmkc_		230	Surfactin synthetase, SrfA {Bacillus subtilis [Tax	96.63
d1pjaa_		268	Palmitoyl protein thioesterase 2 {Human (Homo sapi	96.62
d1tcaa_		317	Triacylglycerol lipase {Yeast (Candida antarctica)	96.36
d1ex9a_		285	Lipase {Pseudomonas aeruginosa [TaxId: 287]}	96.28
d1cvla_		319	Lipase {Chromobacterium viscosum [TaxId: 42739]}	96.18
d1mo2a_		255	Erythromycin polyketide synthase {Saccharopolyspor	96.08
d1xkta_		286	Fatty acid synthase {Human (Homo sapiens) [TaxId:	96.02
d1k8qa_		377	Gastric lipase {Dog (Canis familiaris) [TaxId: 961	95.73
d1brta_		277	Bromoperoxidase A2 {Streptomyces aureofaciens [Tax	95.54
d1ehya_		293	Bacterial epoxide hydrolase {Agrobacterium radioba	95.52
d1vkha_		263	Putative serine hydrolase Ydr428c {Baker's yeast (	95.5
d2h7xa1		283	Picromycin polyketide synthase {Streptomyces venez	95.45
d1c4xa_		281	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	95.38
d1mtza_		290	Tricorn interacting factor F1 {Archaeon Thermoplas	95.32
d1hkha_		279	Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]	95.28
d2fuka1		218	XC6422 protein {Xanthomonas campestris [TaxId: 339	95.17
d1uk8a_		271	Meta-cleavage product hydrolase CumD {Pseudomonas	95.15
d1q0ra_		297	Aclacinomycin methylesterase RdmC {Streptomyces pu	95.14
d1bn7a_		291	Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1	94.97
d3c70a1		256	Hydroxynitrile lyase {Rubber tree (Hevea brasilien	94.87
d1zd3a2		322	Mammalian epoxide hydrolase, C-terminal domain {Hu	94.86
d2rhwa1		283	2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas	94.82
d1a8qa_		274	Bromoperoxidase A1 {Streptomyces aureofaciens [Tax	94.77
d1cexa_		197	Cutinase {Fungus (Fusarium solani), subsp. pisi [T	94.63
d1azwa_		313	Proline iminopeptidase {Xanthomonas campestris, pv	94.61
d2dsta1		122	Hypothetical protein TTHA1544 {Thermus thermophilu	94.61
d1b6ga_		310	Haloalkane dehalogenase {Xanthobacter autotrophicu	94.58
d1imja_		208	Ccg1/TafII250-interacting factor B (Cib) {Human (H	94.53
d1thta_		302	Myristoyl-ACP-specific thioesterase {Vibrio harvey	94.39
d1ei9a_		279	Palmitoyl protein thioesterase 1 {Cow (Bos taurus)	94.38
d1uxoa_		186	Hypothetical protein YdeN {Bacillus subtilis [TaxI	94.06
d3b5ea1		209	Uncharacterized protein Mll8374 {Mesorhizobium lot	93.77
d1r3da_		264	Hypothetical protein VC1974 {Vibrio cholerae [TaxI	93.34
d1j1ia_		268	Meta cleavage compound hydrolase CarC {Janthinobac	93.33
d1mj5a_		298	Haloalkane dehalogenase {Sphingomonas paucimobilis	92.81
d1rp1a2		337	Pancreatic lipase, N-terminal domain {Dog (Canis f	92.69
d1bu8a2		338	Pancreatic lipase, N-terminal domain {Rat (Rattus	92.56
d1m33a_		256	Biotin biosynthesis protein BioH {Escherichia coli	92.21
d1tqha_		242	Carboxylesterase Est {Bacillus stearothermophilus	92.03
d2h1ia1		202	Carboxylesterase {Bacillus cereus [TaxId: 1396]}	91.7
d2jbwa1		360	2,6-dihydropseudooxynicotine hydrolase {Arthrobact	91.04
d1fj2a_		229	Acyl protein thioesterase 1 {Human (Homo sapiens)	90.96
d1xkla_		258	Salicylic acid-binding protein 2 (SABP2) {Common t	90.24
d1va4a_		271	Arylesterase {Pseudomonas fluorescens [TaxId: 294]	89.98
d1a8sa_		273	Chloroperoxidase F {Pseudomonas fluorescens [TaxId	89.59
d2pbla1		261	Uncharacterized protein TM1040_2492 {Silicibacter	89.37
d2r8ba1		203	Uncharacterized protein Atu2452 {Agrobacterium tum	88.34
d1qoza_		207	Acetylxylan esterase {Trichoderma reesei [TaxId: 5	88.16
d1sfra_		288	Antigen 85a {Mycobacterium tuberculosis [TaxId: 17	87.82
d1g66a_		207	Acetylxylan esterase {Penicillium purpurogenum [Ta	86.33
d1xfda2		258	Dipeptidyl aminopeptidase-like protein 6, DPP6, C-	86.31
d1dqza_		280	Antigen 85c {Mycobacterium tuberculosis [TaxId: 17	86.13
d1a88a_		275	Chloroperoxidase L {Streptomyces lividans [TaxId:	85.44
d1wm1a_		313	Proline aminopeptidase {Serratia marcescens [TaxId	84.64
d1r88a_		267	Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta	83.68
d1wb4a1		273	Feruloyl esterase domain of the cellulosomal xylan	83.65
d1auoa_		218	Carboxylesterase {Pseudomonas fluorescens [TaxId:	82.94
d1jfra_		260	Lipase {Streptomyces exfoliatus [TaxId: 1905]}	82.77
d1jkma_		358	Carboxylesterase {Bacillus subtilis, brefeldin A e	81.35
d1jjfa_		255	Feruloyl esterase domain of the cellulosomal xylan	81.03
d1ufoa_		238	Hypothetical protein TT1662 {Thermus thermophilus	80.74

>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]

Probab=99.92  E-value=1.4e-24  Score=203.43  Aligned_cols=116  Identities=23%  Similarity=0.313  Sum_probs=94.4

Q ss_pred             CCCCeEEEEEcCCCCCcccccccccccccccc---c--ccccc--hH----HHHHHHHHHHHHHHhCCccEEEeecchhH
Q 018701          100 DGIPRYVIAFRGTLTKPDSFSRDLELDVHLIR---N--GLHLT--SR----FEIAIQAVRNMVASVGSSNVWLAGHSLGS  168 (351)
Q Consensus       100 ~~~~~iVIAfRGT~~~~d~~~~Dl~~dl~~~~---~--~lh~~--~~----f~~a~~~v~~~~~~~~~~~I~itGHSLGG  168 (351)
                      +.++.||||||||.+..||++ |+.+......   .  .+|.+  ..    ...+.+.|+++++++|+++|++|||||||
T Consensus        71 ~~~k~ivvafRGT~s~~dw~~-Dl~~~~~~~~~~~~~~~vH~GF~~~~~~~~~~v~~~v~~~~~~~~~~~i~vtGHSLGG  149 (269)
T d1tiba_          71 NTNKLIVLSFRGSRSIENWIG-NLNFDLKEINDICSGCRGHDGFTSSWRSVADTLRQKVEDAVREHPDYRVVFTGHSLGG  149 (269)
T ss_dssp             TTTTEEEEEECCCSCTHHHHT-CCCCCEEECTTTSTTCEEEHHHHHHHHHHHHHHHHHHHHHHHHCTTSEEEEEEETHHH
T ss_pred             CCCCEEEEEECCCCCHHHHHH-hcCccceecccCCCCcEeeHHHHHHHHHHHHHHHHHHHHHHHhCCCcceeeeccchHH
Confidence            346899999999999999998 8877554321   1  34541  12    23456778888889999999999999999


Q ss_pred             HHHHHHHHHHHhcCCceeEEEecCCCCCcH-HHHHhcccCCc-eEEeeCc
Q 018701          169 AMAMLAGKTVAKTGVFLEAYLFNPPFVSAP-IERIKDKRVKH-GIRIAGS  216 (351)
Q Consensus       169 ALA~L~a~~l~~~g~~v~~ytFg~PrVgn~-~~~~~~~~~~~-~~Rv~~~  216 (351)
                      |||+|+|..++..+.++.+||||+|||||. |++.+++..+. .+||+|.
T Consensus       150 alA~l~a~~l~~~~~~i~~~tFG~PrvGn~~fa~~~~~~~~~~~~Rvv~~  199 (269)
T d1tiba_         150 ALATVAGADLRGNGYDIDVFSYGAPRVGNRAFAEFLTVQTGGTLYRITHT  199 (269)
T ss_dssp             HHHHHHHHHHTTSSSCEEEEEESCCCCBCHHHHHHHHHCTTSCEEEEEET
T ss_pred             HHHHHHHHHHHhccCcceEEEecCCCcCCHHHHHHHHhhcCCceEEEEeC
Confidence            999999999998899999999999999995 78888877665 5899986

PyMOL of d1tiba_

>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]}	Back information, alignment and structure

>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]}	Back information, alignment and structure

>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]}	Back information, alignment and structure

>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]}	Back information, alignment and structure

>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]}	Back information, alignment and structure

>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]}	Back information, alignment and structure

>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]}	Back information, alignment and structure

>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}	Back information, alignment and structure

>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}	Back information, alignment and structure

>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]}	Back information, alignment and structure

>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}	Back information, alignment and structure

>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]}	Back information, alignment and structure

>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}	Back information, alignment and structure

>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}	Back information, alignment and structure

>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}	Back information, alignment and structure

>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}	Back information, alignment and structure

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}	Back information, alignment and structure

>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}	Back information, alignment and structure

>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}	Back information, alignment and structure

>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]}	Back information, alignment and structure

>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}	Back information, alignment and structure

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}	Back information, alignment and structure

>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]}	Back information, alignment and structure

>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]}	Back information, alignment and structure

>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}	Back information, alignment and structure

>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}	Back information, alignment and structure

>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]}	Back information, alignment and structure

>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]}	Back information, alignment and structure

>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]}	Back information, alignment and structure

>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]}	Back information, alignment and structure

>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]}	Back information, alignment and structure

>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure