Citrus Sinensis ID: 018704

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MSLFKHLLRNPTAKSYSYSSPSIIMPSNLILTCLSHFTTDASPSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGR
ccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHccccccEEEEEccccccccccccHHHccccccccccccccccccccccccccEEEEEEEEEEECccccEEEEEEcccccccccccEEEEcccEEEEcccccccccccccHHHHccccccHHHHHHHHHHHHHHHHccccccccHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEcccEEEECccCEEEccccEEccccEEEcccccccHHHHHcccccccccc
*SLFK**LR************SIIMPSNLILTCLSHFTTDASPSTVQLTQYSGL*******KPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLD********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFKHLLRNPTAKSYSYSSPSIIMPSNLILTCLSHFTTDASPSTVQLTQYSGLGPTKANEKPRVVVLGSGWAGCRLMKGIDTSLYDVVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISREPGSYFFLSHCAGIDTDNHVVHCETVTDELRTLEPWKFKISYDKLVIALGAEASTFGIHGVKENATFLREVHHAQEIRRKLLLNLMLSDVPGISEEEKSRLLHCVVVGGGPTGVEFSGELSDFIMRDVRQRYSHVKDYIHVTLIEANEILSSFDDRLRHYATTQLSKSGVRLVRGIVKDVDSQKLILNDGTEVPYGLLVWSTGVGPSTLVKSLDLPKSPGGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alternative NAD(P)H dehydrogenase 2, mitochondrial probableO80874

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ICS, chain A
Confidence level:very confident
Coverage over the Query: 60-212,228-253,268-350
View the alignment between query and template
View the model in PyMOL
Template: 4G6H, chain A
Confidence level:very confident
Coverage over the Query: 60-350
View the alignment between query and template
View the model in PyMOL