Citrus Sinensis ID: 018713

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-

MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR

cHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHcccccccccccccccEEEEcccccHHHHHHHHHHcccccccEEcccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHccccccEECcccccHHHHHHHHHcccccEEEEEccccccEEEEEcHHHHHHHHHcccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEHHHHHHHHcccccccccc

****************DAYFEAIQ****LPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKD*PTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPEL*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SNF1-related protein kinase regulatory subunit gamma-1-like	Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.	probable	Q9CAR3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V8Q, chain E
Confidence level:very confident
Coverage over the Query: 33-122,138,179-191,203-344
View the alignment between query and template
View the model in PyMOL

Template: 3L2B, chain A
Confidence level:very confident
Coverage over the Query: 43-258
View the alignment between query and template
View the model in PyMOL