Citrus Sinensis ID: 018713


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR
cHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHcccccccccccccccEEEEcccccHHHHHHHHHHcccccccEEcccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHccccccEEEcccccHHHHHHHHHcccccEEEEEccccccEEEEEcHHHHHHHHHcccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHccccEEEEEEccccEEEEEEEHHHHHHHHcccccccccc
ccHHHHHccccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccEEEEccccHHHHHHHHHHHcccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccHHHHHcccHHHccccHHHHHHHccccccEEccccccHHHHHHHHHHccccEEEEEccccccEEEEEcHHHHHHHHHHHcccHHHHHHHHccHHHccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEccccEEEEEEEHHHHHHHHcccHHHHccc
MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFAripvlsfpnvpggrvieimadttIPDAVKILSEcnilsapvkipdapsssdwkerylGIVDYSAIILWVLETAELAAAAFSVGTataagvgtgtVGALGALalgmtgpaaVAGLTVAAAGAAVAGGlaaekgagkdaptaadRLHEDFYKVIlqeepfkstTVRSIIKsyrwapflpvatddSMLSVLLLLSKyrlrnvpiiepgtpdiknYITQSAVVqglegckgrdwfdiiasqpisdlglpfmssdeviTIQSNELILEAFKRMkdnniggipvvegqqkkivgnvsIRDIRhlllkpelfsnfr
maqaeeakevsklsscDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNIlsapvkipdapsssdWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVilqeepfksttvrSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIiepgtpdiknYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIggipvvegqqkkivgnvsirdirhlllkpelfsnfr
MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAElaaaafsvgtataagvgtgtvgalgalalgmtgpaavagltvaaagaavagglaaekgagkdaPTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDsmlsvllllsKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR
****************DAYFEAIQ****LPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDA**SSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAE*********AADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPEL*****
*************************************TAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYK************VRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKP*******
**************SCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLA**********TAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR
************LSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKD*PTAA**LHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELF***R
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAAFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query351 2.2.26 [Sep-21-2011]
Q9CAR3447 SNF1-related protein kina yes no 0.997 0.782 0.746 1e-130
Q8LBB2424 SNF1-related protein kina no no 0.834 0.691 0.353 1e-53
>sp|Q9CAR3|KINGL_ARATH SNF1-related protein kinase regulatory subunit gamma-1-like OS=Arabidopsis thaliana GN=CBSCBS2 PE=2 SV=1 Back     alignment and function desciption
 Score =  466 bits (1199), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 262/351 (74%), Positives = 304/351 (86%), Gaps = 1/351 (0%)

Query: 2   AQAEEAKEV-SKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEI 60
           ++A E KE+ S +SSC+AYFE +QSRK LP SLQETL +AFA IPV SFP VPGGRVIEI
Sbjct: 4   SEAVEDKEIKSAVSSCEAYFEKVQSRKNLPKSLQETLNSAFAGIPVSSFPQVPGGRVIEI 63

Query: 61  MADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAA 120
            A+T + +AVKILS+  ILSAPV   D  SS DW+ERYLGI+DYS+IILWVLE+AELAA 
Sbjct: 64  QAETPVSEAVKILSDSKILSAPVINTDHESSLDWRERYLGIIDYSSIILWVLESAELAAI 123

Query: 121 AFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAP 180
           A S  +ATAAGVG G VGALG  ALGMTGP A AGL  AA GAAVAGG+AAE+G GKDAP
Sbjct: 124 ALSATSATAAGVGAGAVGALGVAALGMTGPVAAAGLAAAAVGAAVAGGVAAERGIGKDAP 183

Query: 181 TAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRN 240
           TAAD+L +DFY+VILQEEPFKSTTVR+I+KS+RWAPFLPV+T+ SMLSV+LLLSKYRLRN
Sbjct: 184 TAADKLGKDFYEVILQEEPFKSTTVRTILKSFRWAPFLPVSTESSMLSVMLLLSKYRLRN 243

Query: 241 VPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSN 300
           VP+I+ G PDIKNY+TQSAVV GLEGCKGRDWFD I++ PISDLGLPFMS +EVI+I+S 
Sbjct: 244 VPVIKTGEPDIKNYVTQSAVVHGLEGCKGRDWFDHISALPISDLGLPFMSPNEVISIESE 303

Query: 301 ELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR 351
           ELILEAFKRM+DNNIGG+PVVEG  KKIVGN+S+RDIR+LLL+PE+FSNFR
Sbjct: 304 ELILEAFKRMRDNNIGGLPVVEGLNKKIVGNISMRDIRYLLLQPEVFSNFR 354




Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8LBB2|KING1_ARATH SNF1-related protein kinase regulatory subunit gamma-1 OS=Arabidopsis thaliana GN=KING1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
357486631443 SNF1-related protein kinase regulatory s 1.0 0.792 0.749 1e-144
225424926444 PREDICTED: SNF1-related protein kinase r 1.0 0.790 0.792 1e-132
224140801443 predicted protein [Populus trichocarpa] 1.0 0.792 0.752 1e-132
255558196443 AMP-activated protein kinase, gamma regu 1.0 0.792 0.769 1e-131
356500477443 PREDICTED: SNF1-related protein kinase r 1.0 0.792 0.760 1e-130
356498190443 PREDICTED: SNF1-related protein kinase r 1.0 0.792 0.774 1e-129
145327199 476 Cystathionine beta-synthase (CBS) protei 0.997 0.735 0.746 1e-129
42563087447 Cystathionine beta-synthase (CBS) protei 0.997 0.782 0.746 1e-129
297841713447 CBS domain-containing protein [Arabidops 0.997 0.782 0.740 1e-126
449434819442 PREDICTED: SNF1-related protein kinase r 0.997 0.791 0.769 1e-125
>gi|357486631|ref|XP_003613603.1| SNF1-related protein kinase regulatory subunit gamma [Medicago truncatula] gi|355514938|gb|AES96561.1| SNF1-related protein kinase regulatory subunit gamma [Medicago truncatula] Back     alignment and taxonomy information
 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 263/351 (74%), Positives = 307/351 (87%)

Query: 1   MAQAEEAKEVSKLSSCDAYFEAIQSRKKLPHSLQETLTAAFARIPVLSFPNVPGGRVIEI 60
           MA  +E +  ++LS CD YFE IQSRKKLP +LQETLT +FA+IPV SFP VPGG+V+EI
Sbjct: 1   MAHEQEVRTSTQLSKCDRYFETIQSRKKLPQTLQETLTDSFAKIPVSSFPGVPGGKVVEI 60

Query: 61  MADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAA 120
           +ADT + +AVKILSE NIL+APVK PDA   SDW++RYLGI+DYSAIILWV+E+AELAA 
Sbjct: 61  LADTPVGEAVKILSESNILAAPVKDPDAGIGSDWRDRYLGIIDYSAIILWVMESAELAAV 120

Query: 121 AFSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAP 180
           A S GTATAAGVG GTVGALGA+ALG TGPAA+AGLT AA GAAV GG+AA+K   KDAP
Sbjct: 121 ALSAGTATAAGVGAGTVGALGAIALGATGPAAIAGLTAAAVGAAVVGGVAADKTMAKDAP 180

Query: 181 TAADRLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRN 240
            AA+ L EDFYKVILQEEPFKSTTVRSI+KSYRWAPF+PVA + +ML+VLLLLSKYRLRN
Sbjct: 181 QAANNLGEDFYKVILQEEPFKSTTVRSILKSYRWAPFVPVAKNSAMLTVLLLLSKYRLRN 240

Query: 241 VPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSN 300
           VP+IEPG  DI N+ITQSAV+QGLEGC+GRDWFD IA++P++DLGLPFMS+D+VI+IQSN
Sbjct: 241 VPVIEPGKADIVNFITQSAVIQGLEGCRGRDWFDCIAARPMADLGLPFMSADKVISIQSN 300

Query: 301 ELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR 351
           ELILEAFK M+DN IGG+PVVEG  K IVGN+SIRDIR+LLLKPE+FSNFR
Sbjct: 301 ELILEAFKIMRDNQIGGLPVVEGPAKTIVGNLSIRDIRYLLLKPEIFSNFR 351




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225424926|ref|XP_002277342.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Vitis vinifera] gi|296086419|emb|CBI32008.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140801|ref|XP_002323767.1| predicted protein [Populus trichocarpa] gi|222866769|gb|EEF03900.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558196|ref|XP_002520125.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223540617|gb|EEF42180.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356500477|ref|XP_003519058.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Glycine max] Back     alignment and taxonomy information
>gi|356498190|ref|XP_003517936.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Glycine max] Back     alignment and taxonomy information
>gi|145327199|ref|NP_001077801.1| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] gi|332196856|gb|AEE34977.1| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42563087|ref|NP_564975.2| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] gi|75262290|sp|Q9CAR3.1|KINGL_ARATH RecName: Full=SNF1-related protein kinase regulatory subunit gamma-1-like; AltName: Full=AKIN subunit gamma-1-like; AltName: Full=CBS domain-containing protein CBSCBS2 gi|12325233|gb|AAG52563.1|AC010675_11 hypothetical protein; 77242-78931 [Arabidopsis thaliana] gi|190684768|gb|ACE82595.1| At1g69800 [Arabidopsis thaliana] gi|222424344|dbj|BAH20128.1| AT1G69800 [Arabidopsis thaliana] gi|332196855|gb|AEE34976.1| Cystathionine beta-synthase (CBS) protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297841713|ref|XP_002888738.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334579|gb|EFH64997.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449434819|ref|XP_004135193.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] gi|449478452|ref|XP_004155322.1| PREDICTED: SNF1-related protein kinase regulatory subunit gamma-1-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query351
TAIR|locus:2114475424 KING1 "AT3G48530" [Arabidopsis 0.464 0.384 0.392 2.3e-50
DICTYBASE|DDB_G0275177304 sigI "CBS (cystathionine-beta- 0.299 0.345 0.284 1.1e-05
DICTYBASE|DDB_G0288201313 DDB_G0288201 [Dictyostelium di 0.410 0.460 0.222 1.6e-05
DICTYBASE|DDB_G0278953359 DDB_G0278953 "CBS (cystathioni 0.438 0.428 0.224 0.00027
UNIPROTKB|Q48IU0146 PSPPH_2494 "CBS domain protein 0.165 0.397 0.409 0.00056
TAIR|locus:4515102654193 AT1G47271 "AT1G47271" [Arabido 0.370 0.673 0.229 0.00085
TAIR|locus:2114475 KING1 "AT3G48530" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 355 (130.0 bits), Expect = 2.3e-50, Sum P(2) = 2.3e-50
 Identities = 64/163 (39%), Positives = 105/163 (64%)

Query:   189 DFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDXXXXXXXXXXKYRLRNVPIIEPGT 248
             +F++V+   E +K+T VR I  ++RWAPFL +  ++          KY+++++P+++ G 
Sbjct:   163 NFFEVLTSSELYKNTKVRDISGTFRWAPFLALQKENSFLTMLLLLSKYKMKSIPVVDLGV 222

Query:   249 PDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELILEAFK 308
               I+N ITQS V+  L  C G  WF+    + +S++GLP MS D +I I  +E +L+AFK
Sbjct:   223 AKIENIITQSGVIHMLAECAGLLWFEDWGIKTLSEVGLPIMSKDHIIKIYEDEPVLQAFK 282

Query:   309 RMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR 351
              M+   IGGIPV+E   +K VGN+S+RD++ LL  PE++ ++R
Sbjct:   283 LMRRKRIGGIPVIERNSEKPVGNISLRDVQFLLTAPEIYHDYR 325


GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009505 "plant-type cell wall" evidence=IDA
DICTYBASE|DDB_G0275177 sigI "CBS (cystathionine-beta-synthase) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288201 DDB_G0288201 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278953 DDB_G0278953 "CBS (cystathionine-beta-synthase) domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q48IU0 PSPPH_2494 "CBS domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
TAIR|locus:4515102654 AT1G47271 "AT1G47271" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9CAR3KINGL_ARATHNo assigned EC number0.74640.99710.7829yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
cd04642126 cd04642, CBS_pair_29, The CBS domain, named after 2e-18
cd04627123 cd04627, CBS_pair_14, The CBS domain, named after 2e-14
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 1e-08
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 2e-08
pfam0057157 pfam00571, CBS, CBS domain 7e-08
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 1e-07
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 2e-07
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 3e-07
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 6e-07
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 1e-06
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 2e-06
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 3e-06
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 8e-06
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 9e-06
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after h 1e-05
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 2e-05
cd04609110 cd04609, CBS_pair_PALP_assoc2, This cd contains tw 2e-05
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 2e-05
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 3e-05
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after h 7e-05
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 1e-04
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 1e-04
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after 1e-04
COG2524294 COG2524, COG2524, Predicted transcriptional regula 2e-04
COG3620187 COG3620, COG3620, Predicted transcriptional regula 2e-04
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 2e-04
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after 2e-04
cd04615113 cd04615, CBS_pair_2, The CBS domain, named after h 3e-04
TIGR01302 450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 3e-04
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 4e-04
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two 4e-04
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 5e-04
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con 5e-04
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 7e-04
cd04626111 cd04626, CBS_pair_13, The CBS domain, named after 8e-04
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 8e-04
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 8e-04
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 9e-04
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after 0.001
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two 0.002
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent i 0.002
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd c 0.002
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 0.002
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after 0.003
PRK13875440 PRK13875, PRK13875, conjugal transfer protein TrbL 0.003
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 0.004
>gnl|CDD|240013 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
 Score = 79.6 bits (197), Expect = 2e-18
 Identities = 26/60 (43%), Positives = 43/60 (71%), Gaps = 1/60 (1%)

Query: 292 DEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKPELFSNFR 351
            +V++I S+E +L+AFK M+ NNI G+PVV+  + K++GN+S  D++ LLL P+    +R
Sbjct: 1   SKVVSIDSDERVLDAFKLMRKNNISGLPVVDE-KGKLIGNISASDLKGLLLSPDDLLLYR 59


CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 126

>gnl|CDD|239999 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|240005 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|226147 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|240009 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239988 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239978 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239998 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|237537 PRK13875, PRK13875, conjugal transfer protein TrbL; Provisional Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 351
COG2524294 Predicted transcriptional regulator, contains C-te 99.76
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 99.74
COG2524294 Predicted transcriptional regulator, contains C-te 99.71
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.67
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.65
COG3620187 Predicted transcriptional regulator with C-termina 99.64
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.59
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.57
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.57
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.56
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 99.56
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.56
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.56
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.55
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.54
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.53
COG3620187 Predicted transcriptional regulator with C-termina 99.53
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.53
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.52
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.52
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.52
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.51
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.51
COG2905 610 Predicted signal-transduction protein containing c 99.5
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 99.5
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.5
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.5
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.49
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.49
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.49
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.49
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.48
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.48
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.48
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 99.48
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 99.48
COG2905 610 Predicted signal-transduction protein containing c 99.48
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.48
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 99.48
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.47
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.47
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.47
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 99.47
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.47
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.46
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.46
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.46
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 99.46
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.46
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.45
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 99.45
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.45
PRK11573413 hypothetical protein; Provisional 99.44
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.44
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.44
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.44
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.44
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.44
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.43
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.43
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.43
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.43
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 99.43
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 99.42
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.42
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.42
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.42
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.42
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.41
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 99.41
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.41
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.41
COG4109 432 Predicted transcriptional regulator containing CBS 99.41
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 99.41
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.41
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.4
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 99.4
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 99.4
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.4
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 99.4
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.39
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.39
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.39
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.38
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 99.38
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.38
PRK01862574 putative voltage-gated ClC-type chloride channel C 99.38
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 99.38
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 99.37
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 99.37
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.37
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.37
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 99.37
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 99.37
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.36
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.36
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 99.36
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.36
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 99.35
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 99.35
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.35
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 99.35
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 99.35
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 99.35
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.35
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 99.35
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 99.35
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.35
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.35
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 99.35
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 99.35
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.34
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 99.34
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 99.34
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.34
PRK11573413 hypothetical protein; Provisional 99.34
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 99.34
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.34
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 99.33
COG0517117 FOG: CBS domain [General function prediction only] 99.33
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 99.33
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.33
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.33
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 99.33
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 99.32
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 99.32
COG1253429 TlyC Hemolysins and related proteins containing CB 99.32
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 99.32
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 99.32
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 99.32
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 99.31
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 99.31
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 99.31
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 99.31
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 99.31
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 99.3
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.3
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 99.3
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 99.29
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 99.29
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 99.29
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 99.29
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.29
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 99.28
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 99.28
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.28
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.28
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 99.27
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.27
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 99.26
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 99.26
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.26
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 99.26
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.26
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.26
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 99.25
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 99.24
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 99.24
PLN02274 505 inosine-5'-monophosphate dehydrogenase 99.24
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 99.24
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 99.24
cd02205113 CBS_pair The CBS domain, named after human CBS, is 99.23
COG0517117 FOG: CBS domain [General function prediction only] 99.22
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.21
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 99.2
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.18
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 99.18
PRK14869 546 putative manganese-dependent inorganic pyrophospha 99.18
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.17
COG4109432 Predicted transcriptional regulator containing CBS 99.17
COG1253429 TlyC Hemolysins and related proteins containing CB 99.16
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 99.16
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 99.14
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 99.13
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 99.13
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 99.12
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 99.1
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.1
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 99.07
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 99.02
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 99.01
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 98.96
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.91
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 98.84
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 98.82
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 98.79
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.71
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.55
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.54
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 98.44
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.3
PRK10070400 glycine betaine transporter ATP-binding subunit; P 98.28
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 98.23
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 98.21
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 97.91
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.91
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.83
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 97.81
smart0011649 CBS Domain in cystathionine beta-synthase and othe 97.75
COG4175386 ProV ABC-type proline/glycine betaine transport sy 97.53
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 97.41
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 96.91
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 95.32
KOG0476931 consensus Cl- channel CLC-2 and related proteins ( 94.65
KOG2118 498 consensus Predicted membrane protein, contains two 93.82
COG4175386 ProV ABC-type proline/glycine betaine transport sy 93.68
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 91.12
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 90.61
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 86.03
KOG2118498 consensus Predicted membrane protein, contains two 82.33
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
Probab=99.76  E-value=8.4e-18  Score=148.57  Aligned_cols=125  Identities=25%  Similarity=0.429  Sum_probs=115.9

Q ss_pred             CCCcCchHhhhhccCCCCcEEecCCCCHHHHHHHHHhCCCCEEEEEcCCCCCEEEEEeHHHHHHHhhcCCCCchhhhhcc
Q 018713          199 PFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIAS  278 (351)
Q Consensus       199 ~~~~~~V~dim~~~~~~~~~~v~~~~sl~ea~~~m~~~~~~~vpVvd~~~g~liGiIt~~dil~~l~~~~~~~~l~~l~~  278 (351)
                      ..+..+|+++|+    ++++++.+++++.|+..+|.+++++..||+|++  +++|++|.+|+..+++++.        .+
T Consensus       168 siPk~~V~~~~s----~~~i~v~~d~tl~eaak~f~~~~i~GaPVvd~d--k~vGiit~~dI~~aia~g~--------~~  233 (294)
T COG2524         168 SIPKEKVKNLMS----KKLITVRPDDTLREAAKLFYEKGIRGAPVVDDD--KIVGIITLSDIAKAIANGN--------LD  233 (294)
T ss_pred             ecCcchhhhhcc----CCceEecCCccHHHHHHHHHHcCccCCceecCC--ceEEEEEHHHHHHHHHcCC--------cc
Confidence            366789999999    669999999999999999999999999999985  9999999999999998873        46


Q ss_pred             CcccccccCccCCCCceEEcCCCcHHHHHHHHHhcCCCeeEEEeCCCCeEEEEEeHHHHHHHhcC
Q 018713          279 QPISDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLK  343 (351)
Q Consensus       279 ~~v~~L~~~~m~~~~v~~V~~~~~l~~al~~m~~~~~~~lpVvd~~~g~liGiIt~~DIl~~l~~  343 (351)
                      .++++    +|. ++++++++|+.+.||+++|..+++.+|.|+|. +|+++|+||.+||+..+..
T Consensus       234 ~kV~~----~M~-k~vitI~eDe~i~dAir~M~~~nVGRLlV~ds-~gkpvGiITrTDIL~~ia~  292 (294)
T COG2524         234 AKVSD----YMR-KNVITINEDEDIYDAIRLMNKNNVGRLLVTDS-NGKPVGIITRTDILTRIAG  292 (294)
T ss_pred             ccHHH----Hhc-cCCceEcCchhHHHHHHHHHhcCcceEEEEcc-CCcEEEEEehHHHHHHhhc
Confidence            78999    797 99999999999999999999999999999998 8999999999999998754



>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query351
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 1e-25
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 2e-15
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 2e-09
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 5e-09
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 2e-21
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 1e-11
2qrd_G 334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 7e-08
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 5e-18
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 5e-14
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 1e-14
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 5e-12
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 2e-10
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 3e-09
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 7e-14
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 2e-07
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 1e-12
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 4e-12
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 4e-07
1pbj_A125 Hypothetical protein; structural genomics, domain, 4e-12
1pbj_A125 Hypothetical protein; structural genomics, domain, 2e-09
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 4e-12
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 1e-10
3ddj_A296 CBS domain-containing protein; structural genomics 2e-11
3ddj_A 296 CBS domain-containing protein; structural genomics 3e-10
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 5e-11
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 3e-07
1o50_A157 CBS domain-containing predicted protein TM0935; CB 8e-11
1o50_A157 CBS domain-containing predicted protein TM0935; CB 1e-08
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 1e-10
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 8e-09
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 2e-10
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 2e-07
2o16_A160 Acetoin utilization protein ACUB, putative; struct 3e-10
2o16_A160 Acetoin utilization protein ACUB, putative; struct 3e-09
4fry_A157 Putative signal-transduction protein with CBS DOM; 3e-10
4fry_A157 Putative signal-transduction protein with CBS DOM; 1e-08
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 3e-10
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 3e-09
3lqn_A150 CBS domain protein; csgid, structural genomics, un 4e-10
3lqn_A150 CBS domain protein; csgid, structural genomics, un 2e-09
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 7e-10
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 5e-09
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 7e-10
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 1e-09
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 1e-08
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 2e-09
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 7e-09
1pvm_A 184 Conserved hypothetical protein TA0289; structural 2e-09
1pvm_A184 Conserved hypothetical protein TA0289; structural 3e-08
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 4e-09
3sl7_A 180 CBS domain-containing protein CBSX2; CBS-PAIR prot 5e-07
1vr9_A 213 CBS domain protein/ACT domain protein; structural 7e-09
1vr9_A213 CBS domain protein/ACT domain protein; structural 2e-08
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 7e-09
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 9e-09
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 4e-08
3fio_A70 A cystathionine beta-synthase domain protein fused 1e-07
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 2e-07
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 3e-07
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 4e-06
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 2e-05
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 4e-07
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 1e-05
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 7e-07
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 8e-06
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 3e-05
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 4e-05
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 4e-05
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 5e-05
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 5e-05
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 2e-04
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 2e-04
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 3e-04
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 5e-04
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 5e-04
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
 Score =  104 bits (260), Expect = 1e-25
 Identities = 24/160 (15%), Positives = 69/160 (43%), Gaps = 3/160 (1%)

Query: 185 RLHEDFYKVILQEEPFKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPII 244
           R ++     I + E  K  T R +     + P + ++ + S+   +  L + ++  +P+I
Sbjct: 96  RYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVI 155

Query: 245 EPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPISDLGLPFMSSDEVITIQSNELIL 304
           +P + +    +T   +++ L+            S+ + +L +   +   +  +++   + 
Sbjct: 156 DPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQI--GTYANIAMVRTTTPVY 213

Query: 305 EAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKP 344
            A      + +  +PVV+ ++ ++V   S  D+ +L  + 
Sbjct: 214 VALGIFVQHRVSALPVVD-EKGRVVDIYSKFDVINLAAEK 252


>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
3ddj_A296 CBS domain-containing protein; structural genomics 99.91
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.91
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.91
3ddj_A296 CBS domain-containing protein; structural genomics 99.91
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.9
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.9
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 99.9
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.9
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.89
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 99.87
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 99.86
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 99.86
4esy_A170 CBS domain containing membrane protein; structural 99.8
4esy_A170 CBS domain containing membrane protein; structural 99.8
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.79
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.78
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.78
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.78
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.78
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.77
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.77
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.77
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.76
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.76
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.75
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.75
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.75
3ocm_A173 Putative membrane protein; structural genomics, PS 99.74
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.74
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.74
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.74
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.74
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.73
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.73
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.73
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.73
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.72
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.72
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.71
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.71
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.71
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.71
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.71
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.71
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.71
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.71
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.7
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.7
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.7
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.7
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.69
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.69
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.69
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.69
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.69
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.67
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.67
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.67
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.67
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.67
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.67
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.66
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.66
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.66
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.66
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.66
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.66
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.65
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.65
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.65
3ocm_A173 Putative membrane protein; structural genomics, PS 99.65
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.64
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.64
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.64
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.64
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.64
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.64
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.64
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.63
1vr9_A213 CBS domain protein/ACT domain protein; structural 99.63
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.63
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.63
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.62
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.62
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.62
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.62
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 99.61
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.61
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.61
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.6
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.6
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.6
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.6
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.59
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 99.59
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.57
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.56
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.56
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.53
2oux_A286 Magnesium transporter; 10001B, structural genomics 99.53
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 99.5
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.5
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 99.49
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.47
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 99.43
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.41
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 99.39
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.35
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.35
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 99.35
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.31
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.26
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 99.25
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.24
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.23
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.23
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.21
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.2
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.17
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.16
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.07
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.04
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 99.01
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 98.97
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.88
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 98.88
3fio_A70 A cystathionine beta-synthase domain protein fused 98.58
3fio_A70 A cystathionine beta-synthase domain protein fused 98.44
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
Probab=99.91  E-value=1.9e-24  Score=200.76  Aligned_cols=196  Identities=16%  Similarity=0.226  Sum_probs=164.0

Q ss_pred             ccCccccCCCCCCCCcEEEcCCCCHHHHHHHHHHcCceecceecCCCCCCCccccceeeEeeHHHHHHHHHHhhHHHhhh
Q 018713           42 ARIPVLSFPNVPGGRVIEIMADTTIPDAVKILSECNILSAPVKIPDAPSSSDWKERYLGIVDYSAIILWVLETAELAAAA  121 (351)
Q Consensus        42 ~~~~v~~~~~~~~~~~i~v~~~~sl~~al~~m~~~~i~~~pVvd~~~~~~~~~~~~~vGiv~~~di~~~~~~~~~~~~~~  121 (351)
                      ...+++++|.   ++++++.+++++.+|++.|.+++++++||+|+++        +++|+++..|++..+          
T Consensus        91 ~~~~v~~im~---~~~~~v~~~~~~~~a~~~m~~~~~~~lpVvd~~~--------~lvGivt~~dl~~~~----------  149 (296)
T 3ddj_A           91 STTPIIDYMT---PNPVTVYNTSDEFTAINIMVTRNFGSLPVVDIND--------KPVGIVTEREFLLLY----------  149 (296)
T ss_dssp             HTSBGGGTSE---ESCCCEETTSCHHHHHHHHHHHTCSEEEEECTTS--------CEEEEEEHHHHGGGG----------
T ss_pred             hcccHHHhcc---CCCEEEcCCCCHHHHHHHHHHcCCCEEEEEcCCC--------cEEEEEeHHHHHHhh----------
Confidence            4688999997   5788999999999999999999999999998753        899999999988321          


Q ss_pred             hccccccccccccccccccchhhccCCCchhhhhhHHhhhhhhhhcccccccCCCCCCchhhhhhhhHHHHHhhhcCCCC
Q 018713          122 FSVGTATAAGVGTGTVGALGALALGMTGPAAVAGLTVAAAGAAVAGGLAAEKGAGKDAPTAADRLHEDFYKVILQEEPFK  201 (351)
Q Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~~~~~~  201 (351)
                                                                                               .  ....
T Consensus       150 -------------------------------------------------------------------------~--~~~~  154 (296)
T 3ddj_A          150 -------------------------------------------------------------------------K--DLDE  154 (296)
T ss_dssp             -------------------------------------------------------------------------G--GSCC
T ss_pred             -------------------------------------------------------------------------h--cccc
Confidence                                                                                     0  1133


Q ss_pred             cCchHhhhhccCCCCcEEecCCCCHHHHHHHHHhCCCCEEEEEcCCCCCEEEEEeHHHHHHHhhcCCCCchhhhhccCcc
Q 018713          202 STTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPI  281 (351)
Q Consensus       202 ~~~V~dim~~~~~~~~~~v~~~~sl~ea~~~m~~~~~~~vpVvd~~~g~liGiIt~~dil~~l~~~~~~~~l~~l~~~~v  281 (351)
                      ..++.++|.    +++.++.+++++.++++.|.+++++++||+|++ |+++|+||.+|+++.+...............++
T Consensus       155 ~~~v~~~m~----~~~~~v~~~~~l~~~~~~m~~~~~~~~~Vvd~~-~~~~Givt~~dl~~~~~~~~~~~~~~~~~~~~v  229 (296)
T 3ddj_A          155 IFPVKVFMS----TKVQTIYKEVRLDQAVKLMLRRGFRRLPVIDDD-NKVVGIVTVVNAIKQLAKAVDKLDPDYFYGKVV  229 (296)
T ss_dssp             CCBHHHHSB----CSCCCEETTSBHHHHHHHHHHHTCSEEEEECTT-SCEEEEEEHHHHHHHHHHHHHHTCTHHHHTCBH
T ss_pred             cccHHHhhc----CCCeEECCCCCHHHHHHHHHHcCCCEEEEEcCC-CEEEEEEEHHHHHHHHHHHHhhcChhhhcCcCH
Confidence            468999998    569999999999999999999999999999974 899999999999998752210000011245678


Q ss_pred             cccccCccCCCCceEEcCCCcHHHHHHHHHhcCCCeeEEEeCCCCeEEEEEeHHHHHHHhcCc
Q 018713          282 SDLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLKP  344 (351)
Q Consensus       282 ~~L~~~~m~~~~v~~V~~~~~l~~al~~m~~~~~~~lpVvd~~~g~liGiIt~~DIl~~l~~~  344 (351)
                      .+    +|. +++++|.+++++.+|+++|.+++.+++||+|+ +|+++|+||..||++.+.+.
T Consensus       230 ~~----~m~-~~~~~v~~~~~l~~a~~~m~~~~~~~l~Vvd~-~g~~~Giit~~Dil~~l~~~  286 (296)
T 3ddj_A          230 KD----VMV-TNLVTIDELASVNRAAAEMIVKRIGSLLILNK-DNTIRGIITERDLLIALHHI  286 (296)
T ss_dssp             HH----HSB-CCCCBCCTTSBHHHHHHHHHHHTCSEEEEECT-TSCEEEEEEHHHHHHHHHHH
T ss_pred             HH----HhC-CCCeEECCCCcHHHHHHHHHHcCCCEEEEECC-CCeEEEEEcHHHHHHHHHHH
Confidence            88    586 88999999999999999999999999999997 89999999999999987643



>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 351
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 1e-08
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 6e-06
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 2e-08
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 3e-08
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 1e-07
d2nyca1140 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's 0.002
d2v8qe1145 d.37.1.1 (E:182-326) 5'-AMP-activated protein kina 2e-07
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 1e-06
d2j9la1169 d.37.1.1 (A:578-746) Chloride channel protein 5, C 9e-06
d1pvma4142 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar 3e-05
d2yzqa1156 d.37.1.1 (A:123-278) Uncharacterized protein PH178 6e-05
d1o50a3145 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th 6e-05
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 7e-05
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 0.001
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 0.002
d1y5ha3123 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M 0.003
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 51.7 bits (123), Expect = 1e-08
 Identities = 21/148 (14%), Positives = 45/148 (30%), Gaps = 7/148 (4%)

Query: 200 FKSTTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSA 259
            KS     +I +          T   +      L    +R  P+ +         +T + 
Sbjct: 10  MKSHRCYDLIPTSSKLVVFD--TSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITD 67

Query: 260 VVQGLEGCKGRDWFDIIASQPISDLGLPF----MSSDEVITIQSNELILEAFKRMKDNNI 315
            +  L          I   +              S   ++ I  N  + +A   +  N I
Sbjct: 68  FINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKI 127

Query: 316 GGIPVVEGQQKKIVGNVSIRDI-RHLLL 342
             +PV++ +    +  ++ + I + L L
Sbjct: 128 HRLPVIDPESGNTLYILTHKRILKFLKL 155


>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query351
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.81
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.81
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.81
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.8
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.8
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.79
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.79
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.78
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.78
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.78
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.77
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.77
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.77
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.77
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.76
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.76
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.75
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.75
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.75
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.75
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.74
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.74
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.74
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.74
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.73
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.73
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.73
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.73
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.73
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.72
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.72
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 99.72
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.72
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.72
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.72
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 99.71
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.71
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 99.71
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.71
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 99.7
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 99.7
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.69
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.69
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.69
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.69
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.67
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.66
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.66
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.64
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.64
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 99.62
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 99.57
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein YkuL
species: Bacillus subtilis [TaxId: 1423]
Probab=99.81  E-value=6.1e-20  Score=148.84  Aligned_cols=129  Identities=17%  Similarity=0.280  Sum_probs=112.5

Q ss_pred             CchHhhhhccCCCCcEEecCCCCHHHHHHHHHhCCCCEEEEEcCCCCCEEEEEeHHHHHHHhhcCCCCchhhhhccCccc
Q 018713          203 TTVRSIIKSYRWAPFLPVATDDSMLSVLLLLSKYRLRNVPIIEPGTPDIKNYITQSAVVQGLEGCKGRDWFDIIASQPIS  282 (351)
Q Consensus       203 ~~V~dim~~~~~~~~~~v~~~~sl~ea~~~m~~~~~~~vpVvd~~~g~liGiIt~~dil~~l~~~~~~~~l~~l~~~~v~  282 (351)
                      .+|+++|.+.  +++.++.+++++.+|++.|.+++++++||+|+ +|+++|++|..|+++++..... ...+.....++.
T Consensus         2 ~tv~~~mip~--~~v~~v~~~~tl~~a~~~m~~~~~s~~pVvd~-~~~~vGiit~~di~~~~~~~~~-~~~~~~~~~~v~   77 (132)
T d1yava3           2 ATVGQFMIEA--DKVAHVQVGNNLEHALLVLTKTGYTAIPVLDP-SYRLHGLIGTNMIMNSIFGLER-IEFEKLDQITVE   77 (132)
T ss_dssp             CBHHHHSEEG--GGSCCEETTCBHHHHHHHHHHHCCSEEEEECT-TCBEEEEEEHHHHHHHHBCSSS-BCGGGTTTSBHH
T ss_pred             CCHHHccccc--cceEEEcCCCCHHHHHHHHHhhCCCceEEeec-ccccccEEEcchhHHHhhcccc-cccccccccccc
Confidence            5789999866  78999999999999999999999999999998 4899999999999999876542 223444567888


Q ss_pred             ccccCccCCCCceEEcCCCcHHHHHHHHHhcCCCeeEEEeCCCCeEEEEEeHHHHHHHhcC
Q 018713          283 DLGLPFMSSDEVITIQSNELILEAFKRMKDNNIGGIPVVEGQQKKIVGNVSIRDIRHLLLK  343 (351)
Q Consensus       283 ~L~~~~m~~~~v~~V~~~~~l~~al~~m~~~~~~~lpVvd~~~g~liGiIt~~DIl~~l~~  343 (351)
                      +    +|. ++++++++++++.+++.+|.+++  .+||+|+ +|+++|+||.+||++.+.+
T Consensus        78 ~----~m~-~~~~~v~~~~~l~~~~~~~~~~~--~l~Vvd~-~~~~~Givt~~dil~~l~~  130 (132)
T d1yava3          78 E----VML-TDIPRLHINDPIMKGFGMVINNG--FVCVEND-EQVFEGIFTRRVVLKELNK  130 (132)
T ss_dssp             H----HSB-CSCCEEETTSBHHHHHHHTTTCS--EEEEECT-TCBEEEEEEHHHHHHHHHH
T ss_pred             c----ccc-ccccccccchhHHHHHHHHHhCC--EEEEEcc-CCEEEEEEEHHHHHHHHHh
Confidence            8    586 89999999999999999998764  5999998 9999999999999998764



>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure