Citrus Sinensis ID: 018772

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSESAASSSSSVSHPSRATSSGITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHIR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccccccccccccccccccccHHcccccHHHHHHHHccc
cccEEEEEEEEcccccccccccEccccccccccEEEEEEccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccHHHHccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEHHHHHccccHHHcccccccccccHHHHHHHHHHHHcccccccccccHEcccccccccccEEEccEEEEccHHHHHHHHHHHHHHHccccccEEccccccccccccEEEEEEccccccccccccccccccccEEEEccccHHHHHHHHccc
MSKRVLCKFfahgaclkgehcefshdwkdppnnictyyqkgfcsygsrcryehvkpsrsesaasssssvshpsratssgitkvpgvmpelsalsrpflppnktawnpesvcndslendevdeprnlkpadrsicsfaaagncprgekcphihgdtcptcgkqclhpfrpeereEHMKSCEKKQKHLEALRRSQEIECSVcldrvlskptaaerkfgllsecdhpfciscirnwrsssptsgmdvntalracpicrklsyfvipsviwyytpeeKQEIIDSYKSKLksidckhfnfgngncpfgtscfykhaytdgrLEEVVLRHlgsddgstviakdirlsefltnmhir
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSrsesaasssssvshpsratssgitkvpgVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNwrsssptsgMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHlgsddgstviakdirlsefltnmhir
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPsrsesaasssssvshpsratssGITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHIR
****VLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYE********************************************************************************ICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLH****************************EIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSS*TSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLT*****
*SKRVLCKFFAHGACLKGEHCEFSHDWKD**N*ICTYYQKGFCSYGSRCRYEHVKPS******************TSSGITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWR**************RACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGR*******************KDIRLSEFLTNMH**
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRY****************************ITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRP*******************LRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHIR
*SKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHV***********************************************************************LKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRL************GSTVIAKDIRLSEFLTNMH**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSESAASSSSSVSHPSRATSSGITKVPGVMPELSALSRPFLPPNKTAWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query350 2.2.26 [Sep-21-2011]
E0X9N4350 Zinc finger CCCH domain-c yes no 0.988 0.988 0.716 1e-144
Q5ZA07368 E3 ubiquitin-protein liga yes no 0.994 0.945 0.647 1e-135
Q6IDS6323 E3 ubiquitin-protein liga yes no 0.92 0.996 0.641 1e-131
Q9H000416 Probable E3 ubiquitin-pro yes no 0.977 0.822 0.361 9e-65
Q9ERV1416 Probable E3 ubiquitin-pro yes no 0.977 0.822 0.361 3e-64
Q9UHC7482 E3 ubiquitin-protein liga no no 0.92 0.668 0.356 2e-63
Q8JFF3435 Probable E3 ubiquitin-pro N/A no 0.891 0.717 0.395 2e-63
Q9TT91478 E3 ubiquitin-protein liga N/A no 0.925 0.677 0.360 7e-63
Q9QXP6481 E3 ubiquitin-protein liga no no 0.92 0.669 0.353 3e-62
Q4VBT5439 Probable E3 ubiquitin-pro yes no 0.897 0.715 0.376 3e-61
>sp|E0X9N4|C3H69_ARATH Zinc finger CCCH domain-containing protein 69 OS=Arabidopsis thaliana GN=At3g63550 PE=3 SV=1 Back     alignment and function desciption
 Score =  511 bits (1315), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 253/353 (71%), Positives = 290/353 (82%), Gaps = 7/353 (1%)

Query: 1   MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSE 60
           MSKR+LCKFFAHGACLKGEHCEFSHDWKDP NNICTYYQKG CSYGSRCRYEHVK SR  
Sbjct: 1   MSKRILCKFFAHGACLKGEHCEFSHDWKDPTNNICTYYQKGICSYGSRCRYEHVKASRPH 60

Query: 61  SAASSSSSVSHPSRATSSGITK---VPGVMP-ELSALSRPFLPPNKTAWNPESVCNDSLE 116
            +ASSSS+V  PS A++S       +PGV   +LS +    L P    WN +S+  DS++
Sbjct: 61  PSASSSSAVPRPSPASASNTLACAFLPGVAERDLSPVPSSSLKPT---WNLDSLHQDSVD 117

Query: 117 NDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHM 176
             +   P  +KP +  ICSFAAAG+CPRG +CPHIHG  CPTCGK CLHPFRP+EREEH 
Sbjct: 118 EVKTSNPGTVKPEELPICSFAAAGDCPRGNECPHIHGTICPTCGKCCLHPFRPDEREEHK 177

Query: 177 KSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSS 236
           K CEKK K LEAL+ SQEIEC VCL+RVLSK T AERKFGLL+ECDH FCI+CIRNWRSS
Sbjct: 178 KVCEKKHKQLEALKLSQEIECCVCLERVLSKATPAERKFGLLTECDHAFCIACIRNWRSS 237

Query: 237 SPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFG 296
           SP++GMDVN+ LRACPICRKLSYFV+PSVIW+  PEEK+EI+D+Y+ KL+SIDCKHF+FG
Sbjct: 238 SPSTGMDVNSTLRACPICRKLSYFVVPSVIWFSAPEEKKEIMDNYREKLRSIDCKHFSFG 297

Query: 297 NGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHI 349
           +GNCPFGTSCFYKHAY DGRLEEVVLRHL ++DG TVIAKDIRLS+FL NMHI
Sbjct: 298 DGNCPFGTSCFYKHAYHDGRLEEVVLRHLDAEDGQTVIAKDIRLSDFLENMHI 350

Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZA07|C3H41_ORYSJ E3 ubiquitin-protein ligase makorin OS=Oryza sativa subsp. japonica GN=MKRN PE=2 SV=1 Back     alignment and function description
>sp|Q6IDS6|C3H35_ARATH E3 ubiquitin-protein ligase makorin OS=Arabidopsis thaliana GN=MKRN PE=2 SV=1 Back     alignment and function description
>sp|Q9H000|MKRN2_HUMAN Probable E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens GN=MKRN2 PE=2 SV=2 Back     alignment and function description
>sp|Q9ERV1|MKRN2_MOUSE Probable E3 ubiquitin-protein ligase makorin-2 OS=Mus musculus GN=Mkrn2 PE=2 SV=2 Back     alignment and function description
>sp|Q9UHC7|MKRN1_HUMAN E3 ubiquitin-protein ligase makorin-1 OS=Homo sapiens GN=MKRN1 PE=1 SV=3 Back     alignment and function description
>sp|Q8JFF3|MKRN1_SERQU Probable E3 ubiquitin-protein ligase makorin-1 OS=Seriola quinqueradiata GN=mkrn1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TT91|MKRN1_MACEU E3 ubiquitin-protein ligase makorin-1 OS=Macropus eugenii GN=MKRN1 PE=2 SV=1 Back     alignment and function description
>sp|Q9QXP6|MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus GN=Mkrn1 PE=2 SV=1 Back     alignment and function description
>sp|Q4VBT5|MKRN1_DANRE Probable E3 ubiquitin-protein ligase makorin-1 OS=Danio rerio GN=mkrn1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query350
255571640361 Makorin-1, putative [Ricinus communis] g 0.997 0.966 0.777 1e-162
224106063391 predicted protein [Populus trichocarpa] 1.0 0.895 0.763 1e-161
225450157361 PREDICTED: E3 ubiquitin-protein ligase m 0.997 0.966 0.754 1e-159
357457691420 E3 ubiquitin-protein ligase makorin [Med 0.974 0.811 0.727 1e-154
356557144363 PREDICTED: E3 ubiquitin-protein ligase m 0.985 0.950 0.733 1e-153
224055241320 predicted protein [Populus trichocarpa] 0.914 1.0 0.757 1e-151
356525651363 PREDICTED: E3 ubiquitin-protein ligase m 0.988 0.953 0.716 1e-150
374110480350 RecName: Full=Zinc finger CCCH domain-co 0.988 0.988 0.716 1e-142
449489044357 PREDICTED: zinc finger CCCH domain-conta 1.0 0.980 0.691 1e-142
297817690353 hypothetical protein ARALYDRAFT_907942 [ 0.988 0.980 0.721 1e-138
>gi|255571640|ref|XP_002526765.1| Makorin-1, putative [Ricinus communis] gi|223533892|gb|EEF35619.1| Makorin-1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/360 (77%), Positives = 307/360 (85%), Gaps = 11/360 (3%)

Query: 1   MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSE 60
           MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKG CSYGSRCRYEHVKP RS+
Sbjct: 1   MSKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGICSYGSRCRYEHVKPLRSD 60

Query: 61  SA-----------ASSSSSVSHPSRATSSGITKVPGVMPELSALSRPFLPPNKTAWNPES 109
           SA           AS+S  + H  R  SS +T V     ELSA   PF PP+  AWN +S
Sbjct: 61  SASSSSTVSYQSLASTSIPLVHSVRTGSSRLTSVHNASGELSASRNPFFPPSNPAWNLDS 120

Query: 110 VCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRP 169
             N+ LEN E+ EPRN+KP D  +CSFAAAGNCPRG+KCPH+HGD CPTCGK CLHPFRP
Sbjct: 121 GPNNLLENGEIIEPRNVKPEDHPLCSFAAAGNCPRGDKCPHVHGDLCPTCGKNCLHPFRP 180

Query: 170 EEREEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISC 229
           EEREEH+++CEKKQKHLEAL+ SQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISC
Sbjct: 181 EEREEHLRTCEKKQKHLEALKHSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISC 240

Query: 230 IRNWRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSID 289
           IRNWRSSSPTSGMDVNTALRACPICRKLSYFV+PSVIWY + EEKQEI+DSYK+KL SID
Sbjct: 241 IRNWRSSSPTSGMDVNTALRACPICRKLSYFVVPSVIWYSSKEEKQEIVDSYKAKLSSID 300

Query: 290 CKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHI 349
           CKHF+FGNGNCPFGTSCFYKHA+ DGRLEEV LRHLG++DG TVIAKDIRLS+FL ++ I
Sbjct: 301 CKHFDFGNGNCPFGTSCFYKHAFRDGRLEEVALRHLGAEDGQTVIAKDIRLSDFLGSLQI 360

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106063|ref|XP_002314030.1| predicted protein [Populus trichocarpa] gi|222850438|gb|EEE87985.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225450157|ref|XP_002279882.1| PREDICTED: E3 ubiquitin-protein ligase makorin-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357457691|ref|XP_003599126.1| E3 ubiquitin-protein ligase makorin [Medicago truncatula] gi|355488174|gb|AES69377.1| E3 ubiquitin-protein ligase makorin [Medicago truncatula] Back     alignment and taxonomy information
>gi|356557144|ref|XP_003546878.1| PREDICTED: E3 ubiquitin-protein ligase makorin-like [Glycine max] Back     alignment and taxonomy information
>gi|224055241|ref|XP_002298439.1| predicted protein [Populus trichocarpa] gi|222845697|gb|EEE83244.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356525651|ref|XP_003531437.1| PREDICTED: E3 ubiquitin-protein ligase makorin-like [Glycine max] Back     alignment and taxonomy information
>gi|374110480|sp|E0X9N4.1|C3H69_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 69; Short=AtC3H69 gi|304557030|gb|ADM35936.1| CCCH-type zinc finger protein C3H69 [Arabidopsis thaliana] gi|304557036|gb|ADM35941.1| CCCH-type zinc finger protein C3H69 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449489044|ref|XP_004158198.1| PREDICTED: zinc finger CCCH domain-containing protein 69-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297817690|ref|XP_002876728.1| hypothetical protein ARALYDRAFT_907942 [Arabidopsis lyrata subsp. lyrata] gi|297322566|gb|EFH52987.1| hypothetical protein ARALYDRAFT_907942 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query350
TAIR|locus:2831040323 AT3G08505 [Arabidopsis thalian 0.668 0.724 0.746 2.1e-128
RGD|1310618417 Mkrn2 "makorin, ring finger pr 0.731 0.613 0.384 1.4e-68
MGI|MGI:1914277416 Mkrn2 "makorin, ring finger pr 0.611 0.514 0.421 9.8e-68
UNIPROTKB|G3V789481 Mkrn1 "Protein Mkrn1" [Rattus 0.597 0.434 0.415 2e-67
UNIPROTKB|Q9UHC7482 MKRN1 "E3 ubiquitin-protein li 0.617 0.448 0.401 3.3e-67
UNIPROTKB|F1M3I4417 Mkrn2 "Protein Mkrn2" [Rattus 0.731 0.613 0.384 4.2e-67
UNIPROTKB|F1SRP7482 MKRN1 "Uncharacterized protein 0.617 0.448 0.401 4.2e-67
UNIPROTKB|E2REH2416 MKRN2 "Uncharacterized protein 0.688 0.579 0.388 4.2e-67
UNIPROTKB|Q9H000416 MKRN2 "Probable E3 ubiquitin-p 0.62 0.521 0.411 8.7e-67
MGI|MGI:1859353481 Mkrn1 "makorin, ring finger pr 0.597 0.434 0.410 1.1e-66
TAIR|locus:2831040 AT3G08505 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1017 (363.1 bits), Expect = 2.1e-128, Sum P(2) = 2.1e-128
 Identities = 177/237 (74%), Positives = 204/237 (86%)

Query:   116 ENDEVDEPRN---LKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEER 172
             +N++ D+  N   + P +  ICSFAAAG+CPRG +CPH+HGD C TCGK+CLHPFRPEER
Sbjct:    86 DNNDGDKSSNVYCIHPREYPICSFAAAGDCPRGNQCPHMHGDLCNTCGKKCLHPFRPEER 145

Query:   173 EEHMKSCEKKQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRN 232
             EEH K CEKKQKH+EAL++SQ+IECSVCLDR+LSK T  ERKFGLL+ECDHPFCI CIRN
Sbjct:   146 EEHTKECEKKQKHIEALKQSQDIECSVCLDRILSKATPGERKFGLLTECDHPFCIQCIRN 205

Query:   233 WRSSSPTSGMDVNTALRACPICRKLSYFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKH 292
             WRSS+P SGMDVN+ LRACPICRKLSYFV+PSV+WY +PEEK+EIID YK+KL+SIDCKH
Sbjct:   206 WRSSAPVSGMDVNSTLRACPICRKLSYFVVPSVVWYSSPEEKKEIIDIYKAKLRSIDCKH 265

Query:   293 FNFGNGNCPFGTSCFYKHAYTDGRLEEVVLRHLGSDDGSTVIAKDIRLSEFLTNMHI 349
             FNFGNGNCPFG SCFYKHAY+DG LEEVVLRHLGS +G TVI   IRLSEFL  + I
Sbjct:   266 FNFGNGNCPFGASCFYKHAYSDGHLEEVVLRHLGSQEGETVITDSIRLSEFLGGLQI 322
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
RGD|1310618 Mkrn2 "makorin, ring finger protein, 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914277 Mkrn2 "makorin, ring finger protein, 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V789 Mkrn1 "Protein Mkrn1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UHC7 MKRN1 "E3 ubiquitin-protein ligase makorin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3I4 Mkrn2 "Protein Mkrn2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRP7 MKRN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2REH2 MKRN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H000 MKRN2 "Probable E3 ubiquitin-protein ligase makorin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1859353 Mkrn1 "makorin, ring finger protein, 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6IDS6C3H35_ARATH6, ., 3, ., 2, ., -0.64180.920.9969yesno
E0X9N4C3H69_ARATHNo assigned EC number0.71670.98850.9885yesno
Q6GLD9MKRN2_XENTR6, ., 3, ., 2, ., -0.35360.97420.8157yesno
Q9ERV1MKRN2_MOUSE6, ., 3, ., 2, ., -0.36130.97710.8221yesno
Q5ZA07C3H41_ORYSJ6, ., 3, ., 2, ., -0.64750.99420.9456yesno
Q9H000MKRN2_HUMAN6, ., 3, ., 2, ., -0.36130.97710.8221yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
PHA03096284 PHA03096, PHA03096, p28-like protein; Provisional 9e-14
PHA02926242 PHA02926, PHA02926, zinc finger-like protein; Prov 3e-11
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 3e-11
COG5084285 COG5084, YTH1, Cleavage and polyadenylation specif 0.002
smart0035627 smart00356, ZnF_C3H1, zinc finger 0.002
cd0016245 cd00162, RING, RING-finger (Really Interesting New 0.003
smart0035627 smart00356, ZnF_C3H1, zinc finger 0.004
>gnl|CDD|222981 PHA03096, PHA03096, p28-like protein; Provisional Back     alignment and domain information 
 Score = 70.2 bits (172), Expect = 9e-14
 Identities = 46/168 (27%), Positives = 68/168 (40%), Gaps = 36/168 (21%)

Query: 141 NCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCEKKQKHLEALRRSQEIECSVC 200
           NC +G+ C ++HGD C  C K  LHP   ++R    K+C   Q  L   +      C +C
Sbjct: 130 NCYKGKYCEYLHGDICDICEKYLLHPTDIKQRYNEQKTCLSYQLRLLLSKI-----CGIC 184

Query: 201 LDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLSYF 260
           L+ + +K    ++ +G+LSE  H F I CI+ W        M  +      P  R+L+  
Sbjct: 185 LENIKAKYI-IKKYYGILSEIKHEFNIFCIKIW--------MTESLYKETEPENRRLNTV 235

Query: 261 V-------------IPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNF 295
           +             IPS  W         I D Y   L S   K  + 
Sbjct: 236 IVFIEKINEDLKNNIPSRYW---------IDDKYDKNLLSFRYKKMHI 274

Length = 284
>gnl|CDD|165237 PHA02926, PHA02926, zinc finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227416 COG5084, YTH1, Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 350
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 100.0
PHA03096284 p28-like protein; Provisional 99.97
PHA02926242 zinc finger-like protein; Provisional 99.84
PHA02929238 N1R/p28-like protein; Provisional 99.49
KOG1040325 consensus Polyadenylation factor I complex, subuni 99.1
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.04
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.87
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.81
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.81
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.69
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.66
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.65
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.63
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 98.63
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.61
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.61
COG5152259 Uncharacterized conserved protein, contains RING a 98.56
KOG1763 343 consensus Uncharacterized conserved protein, conta 98.51
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.49
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.45
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.44
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 98.41
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 98.39
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.37
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.36
PF1463444 zf-RING_5: zinc-RING finger domain 98.35
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.32
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.29
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.23
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 98.22
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 98.18
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.14
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.07
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.04
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.97
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.97
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.96
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.95
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.91
KOG1763343 consensus Uncharacterized conserved protein, conta 97.89
COG5252299 Uncharacterized conserved protein, contains CCCH-t 97.86
smart0035627 ZnF_C3H1 zinc finger. 97.85
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.84
KOG1040325 consensus Polyadenylation factor I complex, subuni 97.82
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 97.81
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 97.78
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.73
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.7
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.64
smart0035627 ZnF_C3H1 zinc finger. 97.58
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 97.53
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.38
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.3
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.21
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.06
KOG4791 667 consensus Uncharacterized conserved protein [Funct 97.05
COG5252299 Uncharacterized conserved protein, contains CCCH-t 96.98
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.96
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.93
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.9
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 96.83
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 96.7
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 96.68
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.66
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 96.43
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.42
KOG4791 667 consensus Uncharacterized conserved protein [Funct 96.42
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.29
COG52191525 Uncharacterized conserved protein, contains RING Z 96.17
KOG2660 331 consensus Locus-specific chromosome binding protei 96.1
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 96.03
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.02
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 95.83
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.8
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.8
KOG2185486 consensus Predicted RNA-processing protein, contai 95.74
KOG1941518 consensus Acetylcholine receptor-associated protei 95.72
COG5222427 Uncharacterized conserved protein, contains RING Z 95.64
KOG0297 391 consensus TNF receptor-associated factor [Signal t 95.56
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.46
KOG2333 614 consensus Uncharacterized conserved protein [Gener 95.42
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.42
KOG2185486 consensus Predicted RNA-processing protein, contai 95.37
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 95.35
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.15
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 94.7
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 94.53
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 94.19
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 94.07
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 93.95
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.65
KOG1002 791 consensus Nucleotide excision repair protein RAD16 93.48
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 93.19
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 92.82
PF04641260 Rtf2: Rtf2 RING-finger 92.62
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.05
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 91.01
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.75
KOG3799169 consensus Rab3 effector RIM1 and related proteins, 90.24
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.71
KOG4739233 consensus Uncharacterized protein involved in syna 89.44
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 89.19
COG5152259 Uncharacterized conserved protein, contains RING a 88.9
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 88.88
PF10272358 Tmpp129: Putative transmembrane protein precursor; 88.59
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 87.76
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 87.11
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 87.01
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 85.03
KOG2333 614 consensus Uncharacterized conserved protein [Gener 84.99
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 84.38
PHA02825162 LAP/PHD finger-like protein; Provisional 84.35
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 81.8
KOG1001674 consensus Helicase-like transcription factor HLTF/ 81.45
COG5236 493 Uncharacterized conserved protein, contains RING Z 81.43
KOG3053 293 consensus Uncharacterized conserved protein [Funct 80.98
KOG3039303 consensus Uncharacterized conserved protein [Funct 80.53
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.1e-51  Score=394.52  Aligned_cols=302  Identities=30%  Similarity=0.582  Sum_probs=226.0

Q ss_pred             CCCCCCCCCCCCccCCCCCCCCCCCccCCCCCCCCCcccCCC-CCCCCCCCCCCCCCCCCCCCCcccccCCCCCCCCCCC
Q 018772           25 HDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSRSESAASSS-SSVSHPSRATSSGITKVPGVMPELSALSRPFLPPNKT  103 (350)
Q Consensus        25 H~~~~~~~~~C~~f~~G~C~~G~~C~y~H~~~~~~~~~~~~~-~~~~~s~~~s~~~~~~~~~~~~~~s~~~~p~~~p~~~  103 (350)
                      ||+..+...||+||++|.|++|+.|||+|+.+.........+ ++..++..       +......+.++       .+.+
T Consensus         1 ~d~~~~~~tic~~~~~g~c~~g~~cr~~h~~~~~~~~~~~~~~~s~~~~~~-------~~~~~~~~~~~-------~~~~   66 (344)
T KOG1039|consen    1 HDLSLSQETICKYYQKGNCKFGDLCRLSHSLPDEEFATLLTPTTSSAAAST-------GLSQSLIWANA-------VADA   66 (344)
T ss_pred             CccccccchhhhhcccccccccceeeeeccCchhhcccccccccccccccc-------ccchhhcccch-------hhcc
Confidence            677665558999999999999999999999995221111111 11101000       00000000000       0000


Q ss_pred             CCCCCCCCCCCCcccccCCCCCCCCCCCccCchhhcCCCCCCCCCcccCCCCCCcCCccccCCCChHHHHHHHHHHH-H-
Q 018772          104 AWNPESVCNDSLENDEVDEPRNLKPADRSICSFAAAGNCPRGEKCPHIHGDTCPTCGKQCLHPFRPEEREEHMKSCE-K-  181 (350)
Q Consensus       104 ~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~C~~~~~G~C~~G~~C~~~Hg~~c~~c~~~~lhP~~~~~~~~h~~~c~-~-  181 (350)
                      .+. .+........+.............++|++.+.|.|.+|..|.++|+..|++|+.+.+||.+..+++.|++.|. . 
T Consensus        67 s~~-~s~~~~~~~~~~~~s~~~~~~s~~~~~~~~~~~~~~~g~~~~~~~~~~~~~c~l~~~~pi~~~~~~~~~~~~~~~~  145 (344)
T KOG1039|consen   67 SAT-MSVSSRPVLTAIRASSSISEPSSTQENPYSNHGQCRFGNGDVTLNGNNPESCGLGTQHPICKRQYKNSMKRGSSCA  145 (344)
T ss_pred             ccc-cchhcccchhhhhhhhccccccccccCccccccccccCCcccccccccccccccccccchhHHHHhhhhccccccc
Confidence            000 0000000000011111122344568899999999999999999999999999999999999999999999883 3 


Q ss_pred             ---HHHHHHHhhcccCccccccccccccCCcccccceeecCCCCCcCcHHHHHHHhhhCCCCCCccccccccCCCCcccc
Q 018772          182 ---KQKHLEALRRSQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLS  258 (350)
Q Consensus       182 ---~~~~~~~~~~s~~~~C~ICle~v~~k~~~~~~~fgil~~C~H~FC~~CI~~W~~~~~~~~~~~~~~~~~CP~CR~~~  258 (350)
                         ..++.++++.+++.+||||||.|++|+ +++++||||+||+|.||++||++|+..+++    ..+++++||+||+.+
T Consensus       146 ~~~~~e~~~a~~~s~~k~CGICme~i~ek~-~~~~rfgilpnC~H~~Cl~Cir~wr~~~q~----~~~~sksCP~CRv~s  220 (344)
T KOG1039|consen  146 LSSAMERSFALQKSSEKECGICMETINEKA-ASERRFGILPNCNHSFCLNCIRKWRQATQF----ESKTSKSCPFCRVPS  220 (344)
T ss_pred             chHhhhhccCcCccccccceehhhhccccc-hhhhhcccCCCcchhhhhcHhHhhhhhhcc----ccccccCCCcccCcc
Confidence               345678899999999999999999999 899999999999999999999999988875    568899999999999


Q ss_pred             ceeecCcccccCchhHHHHHHHHHhhcCCCCCCcccCCCCCCCCCCCceeeccCCCCCchhhhh----hcccCCCCCee-
Q 018772          259 YFVIPSVIWYYTPEEKQEIIDSYKSKLKSIDCKHFNFGNGNCPFGTSCFYKHAYTDGRLEEVVL----RHLGSDDGSTV-  333 (350)
Q Consensus       259 ~~v~ps~~w~~~~~ek~~li~~yk~~~~~~~c~~f~~~~g~Cpfg~~C~y~H~~~~g~~~~~~~----r~~~~~~g~~~-  333 (350)
                      .+|+|+.+||+++++|+++|++|+++|+.++|+||++|.|.||||+.|||+|.+|+|...++..    |.. ...+.+. 
T Consensus       221 ~~v~pS~~Wv~t~~~k~~li~e~~~~~s~~~c~yf~~~~g~cPf~s~~~y~h~~~~~~~~~~~~~~~~~~~-~~~~~~~~  299 (344)
T KOG1039|consen  221 SFVNPSSFWVETKEEKQKLIEEYEAEMSAKDCKYFSQGLGSCPFGSKCFYKHLLPSGASTDPGRQYSPRRP-SNLNTYTN  299 (344)
T ss_pred             ccccccceeeeecccccccHHHHHHHhhccchhhhcCCCCCCCCCCccccccccccccccccCCCCccccc-ccCcchhh
Confidence            9999999999999999999999999999999999999999999999999999999999988852    222 2333333 


Q ss_pred             ecccchHHHHhhhc
Q 018772          334 IAKDIRLSEFLTNM  347 (350)
Q Consensus       334 ~~~~~~l~~~~~~~  347 (350)
                      +...+.++++|++.
T Consensus       300 ~~~~~~~~~~~~~~  313 (344)
T KOG1039|consen  300 ILETTLTLRSLERN  313 (344)
T ss_pred             cccceeehhhhhhh
Confidence            66777777777764

>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query350
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 1e-13
2rhk_C72 Cleavage and polyadenylation specificity factor su 8e-13
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 2e-11
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-05
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 7e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 9e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 9e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 5e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 7e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 7e-04
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
 Score = 64.5 bits (157), Expect = 1e-13
 Identities = 18/56 (32%), Positives = 26/56 (46%)

Query: 3  KRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQKGFCSYGSRCRYEHVKPSR 58
          K V+CK +  G C KG+ CEF H++       C +Y K        C + H+ P  
Sbjct: 9  KTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPES 64
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query350
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 99.52
2rhk_C72 Cleavage and polyadenylation specificity factor su 99.5
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 99.29
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 99.24
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.24
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.2
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 99.17
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.15
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.13
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.1
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.1
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.09
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.08
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.08
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.06
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.06
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.05
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.03
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.03
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 99.02
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.0
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.99
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.99
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.98
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.98
2ysl_A73 Tripartite motif-containing protein 31; ring-type 98.97
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 98.97
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.96
2ect_A78 Ring finger protein 126; metal binding protein, st 98.95
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.93
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 98.93
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.91
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.9
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.89
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.89
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.87
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.87
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.86
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.85
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 98.85
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.85
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.84
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.84
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.84
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.82
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.82
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.82
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.8
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.8
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 98.8
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.79
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.77
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.76
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.76
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.74
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.73
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.69
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.68
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.65
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.61
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.59
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.58
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.54
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.49
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.46
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.46
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.46
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.44
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 98.42
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.41
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.35
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.35
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.24
2ea5_A68 Cell growth regulator with ring finger domain prot 98.21
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 98.19
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.07
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.95
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.88
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 97.87
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.85
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.77
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 96.9
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.6
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.26
3nw0_A238 Non-structural maintenance of chromosomes element 96.25
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.15
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 94.42
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 94.11
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 92.96
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 92.41
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 89.59
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 82.85
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.52  E-value=4.5e-15  Score=114.69  Aligned_cols=57  Identities=37%  Similarity=0.888  Sum_probs=52.7

Q ss_pred             CCCccccccccccCCCCCCCCCCCCCCCCCCCCCCccCC-CCCCCCCCCccCCCCCCCC
Q 018772            2 SKRVLCKFFAHGACLKGEHCEFSHDWKDPPNNICTYYQK-GFCSYGSRCRYEHVKPSRS   59 (350)
Q Consensus         2 tk~~~C~~f~~G~C~~G~~C~f~H~~~~~~~~~C~~f~~-G~C~~G~~C~y~H~~~~~~   59 (350)
                      .|+++|+||++|.|++|++|+|+|++...++++|+||++ |.|. |++|+|.|..++..
T Consensus         8 ~k~~~C~~fl~G~C~~G~~C~fsH~~~~~~~~~C~~f~~~G~C~-~~~C~f~H~~~~~~   65 (77)
T 2d9n_A            8 EKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECS-NKECPFLHIDPESK   65 (77)
T ss_dssp             CTTSBCHHHHTTCCSCTTSSSSBCSCCTTTSCBCHHHHHTCCCC-CSSCSSBCCCTTSS
T ss_pred             CcceeCHhHccCcCCCCCCCCCccccccCcCCCCcccCCCCccC-CCCeeccCCCcccc
Confidence            378999999999999999999999998878889999998 9999 99999999998654
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 350
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.002
d2cqea229 g.66.1.1 (A:429-457) Zinc finger CCCH domain-conta 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 36.8 bits (85), Expect = 2e-04
 Identities = 17/63 (26%), Positives = 23/63 (36%), Gaps = 16/63 (25%)

Query: 194 EIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPI 253
            +EC+VCL  +         +   L  C H F   C+  W  S  T           CP+
Sbjct: 5   GVECAVCLAEL-----EDGEEARFLPRCGHGFHAECVDMWLGSHST-----------CPL 48

Query: 254 CRK 256
           CR 
Sbjct: 49  CRL 51
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query350
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.26
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.23
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.19
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.18
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.07
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.07
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.07
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.06
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.04
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.01
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.0
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.96
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.83
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.81
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.66
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.46
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.02
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.98
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.77
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.59
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.57
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.55
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.29
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.19
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 96.24
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 95.45
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 85.08
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.26  E-value=1.1e-12  Score=93.15  Aligned_cols=51  Identities=31%  Similarity=0.811  Sum_probs=40.4

Q ss_pred             ccCccccccccccccCCcccccceeecCCCCCcCcHHHHHHHhhhCCCCCCccccccccCCCCcccc
Q 018772          192 SQEIECSVCLDRVLSKPTAAERKFGLLSECDHPFCISCIRNWRSSSPTSGMDVNTALRACPICRKLS  258 (350)
Q Consensus       192 s~~~~C~ICle~v~~k~~~~~~~fgil~~C~H~FC~~CI~~W~~~~~~~~~~~~~~~~~CP~CR~~~  258 (350)
                      .++.+|+|||+.+.+.     .....|+.|+|.||.+||.+|.+.+           .+||+||..+
T Consensus         3 ed~~~C~ICl~~~~~~-----~~~~~l~~C~H~Fh~~Ci~~Wl~~~-----------~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDG-----EEARFLPRCGHGFHAECVDMWLGSH-----------STCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTT-----SCCEECSSSCCEECTTHHHHTTTTC-----------CSCSSSCCCS
T ss_pred             CCCCCCeEECccccCC-----CEEEEeCCCCCcccHHHHHHHHHhC-----------CcCCCCCCEe
Confidence            3567899999996542     2235677899999999999999764           3899999864
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure