Citrus Sinensis ID: 018776


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MNKNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFSYGWYFTFIQGFVYLVLIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDKPIKRTATSSFKVNIRKLSFSEREEADEEKRAPV
ccccccccccEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHcHcccccc
**********LFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFSYGWYFTFIQGFVYLVLIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPAD***********************************
xxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxHHxxxxHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKNEEQTRSLFGISLTDRPKWQQFLICSSGFFFGYLVNGVCEEYVYNRLQFSYGWYFTFIQGFVYLVLIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDKPIKRTATSSFKVNIRKLSFSEREEADEEKRAPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-galactose/UDP-glucose transporter 2 Sugar transporter involved in the transport of UDP-galactose form the cytoplasm into the Golgi apparatus.confidentQ29Q28
UDP-galactose/UDP-glucose transporter 4 Sugar transporter involved in the transport of nucleotide-sugars from cytoplasm into the Golgi and/or the endoplasmic reticulum.probableQ9LDX3
Adenosine 3'-phospho 5'-phosphosulfate transporter 2 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. Essential for viability. Involved in glycosaminoglycan synthesis and the subsequent signaling. May be involved in hh and dpp signaling by controlling the sulfation of heparan sulfate (HS).probableQ7Q5D4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 245-313
View the alignment between query and template
View the model in PyMOL
Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 91-160
View the alignment between query and template
View the model in PyMOL