Citrus Sinensis ID: 018790


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350
MSSSSSSAFGFREAEPDGKQFYSRKEKSLGLLCSKFLKLYNRDGVESIGLDDAASRLGVERRRIYDVVNILESIGVVARQAKNLYSWQGFDAIPEALEVLKEEGLRENFNINGCTNSGNVLNDNENEGSTCTVTDGQDSSSSKIESKREKSLWLLTQNFVKLFLCSDVDMITLDSAAMALLGDSNNSTAMRKSRKPAFRWLGWKGNPCNRSAGFLDLNEPKKRVFGTDITNLRLKKNKVDSLTEKKSNPKLNVPKYFKHCNEESNPDESRLEQHSKHKSKGFVYGPFTPASISGIHDSRSKNTKQVLDFASLASTFRPKYHNEAVNGLFGHYVEAWKSWYAEVGDKEQKT
ccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccCEcHHHHHHHHccccEEEEEHHHHHHHHccEEEcccccCEECccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc
***************************SLGLLCSKFLKLYNRDGVESIGLDDAASRLGVERRRIYDVVNILESIGVVARQAKNLYSWQGFDAIPEALEVLKEEGLRENFN*NGC*****VLN*NENE***********************SLWLLTQNFVKLFLCSDVDMITLDSAAMALLG**************AFRWLGWK****************************************************************************************************QVLDFASLASTFRPKYHNEAVNGLFGHYVEAWKSWYAEVGD*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSSSSAFGFREAEPDGKQFYSRKEKSLGLLCSKFLKLYNRDGVESIGLDDAASRLGVERRRIYDVVNILESIGVVARQAKNLYSWQGFDAIPEALEVLKEEGLRENFNINGCTNSGNVLNDNENEGSTCTVTDGQDSSSSKIESKREKSLWLLTQNFVKLFLCSDVDMITLDSAAMALLGDSNNSTAMRKSRKPAFRWLGWKGNPCNRSAGFLDLNEPKKRVFGTDITNLRLKKNKVDSLTEKKSNPKLNVPKYFKHCNEESNPDESRLEQHSKHKSKGFVYGPFTPASISGIHDSRSKNTKQVLDFASLASTFRPKYHNEAVNGLFGHYVEAWKSWYAEVGDKEQKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E2F transcription factor-like E2FF Inhibitor of E2F-dependent activation of gene expression. Binds specifically the E2 recognition site without interacting with DP proteins and prevents transcription activation by E2F/DP heterodimers. Does not bind retinoblastoma-related proteins. Acts as a growth regulator but is not associated with changes in the expression of cell cycle marker genes or in nuclear ploidy levels. Has no effect on cell proliferation, but may repress cell wall biosynthesis genes during cell elongation in differentiated cells.probableQ8RWL0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CF7, chain A
Confidence level:very confident
Coverage over the Query: 23-88
View the alignment between query and template
View the model in PyMOL
Template: 1CF7, chain A
Confidence level:very confident
Coverage over the Query: 146-201
View the alignment between query and template
View the model in PyMOL
Template: 2KGF, chain A
Confidence level:probable
Coverage over the Query: 283-346
View the alignment between query and template
View the model in PyMOL