Citrus Sinensis ID: 018814

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350

MASNSSKSPMLPVSEPARGDEGEKERLLKGDEKLFRGSAMTRRGANAAISYMACAVLLVMFNKAALSSYNFPCANVITLLQMISSCSFLYFLRRWKIINFTMGDSLMTSDSSSTFVPLKTLMHTLPLAVAYLLYMVVSVESVRGVNVPMYTTLRRTTVAFTMIMEYFLAGQKYTPPVVGSVGLIILGAFVAGARDLSFDFFGYAVVFLANITTAIYLATIARIGKSSGLNSFGLMWCNGVICGPLLLLWTFLRGDLETTINFPYLLSPGFLVVLCFSCILAFFLNYSIFLNTTLNSAVTQTICGNLKDLFTIGLGWILFGGLPFDFLNVFGQLLGFLGSGLYAYYKLVGK

cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccECcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHEEEEccc

******************************************RGANAAISYMACAVLLVMFNKAALSSYNFPCANVITLLQMISSCSFLYFLRRWKIINFTMGDSLMTSDSSSTFVPLKTLMHTLPLAVAYLLYMVVSVESVRGVNVPMYTTLRRTTVAFTMIMEYFLAGQKYTPPVVGSVGLIILGAFVAGARDLSFDFFGYAVVFLANITTAIYLATIARIGKSSGLNSFGLMWCNGVICGPLLLLWTFLRGDLETTINFPYLLSPGFLVVLCFSCILAFFLNYSIFLNTTLNSAVTQTICGNLKDLFTIGLGWILFGGLPFDFLNVFGQLLGFLGSGLYAYYKLVG*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-sugar transporter sqv-7	Involved in the import of UDP-glucuronic acid (UDP-GlcA), UDP-N-acetylgalactosamine (UDP-GalNAc) and UDP-galactose (UDP-Gal) from the cytoplasm into the Golgi lumen for the biosynthesis of glycoconjugates that play a pivotal role in development.	probable	Q18779

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 277-345
View the alignment between query and template
View the model in PyMOL

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 128-194
View the alignment between query and template
View the model in PyMOL