Citrus Sinensis ID: 018827

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350

MVTGNNSHQEDGDRQQPAAKGGGATRSWGTTVSGQSVSTSGSVGSPSQSMATPASDSTFLRLNHLDIHGDDAGSQGAVVGGKKKKRGQRAGGGDKSGRGLRQFSMKVCEKVESKGRTTYNEVADELVAEFADPSNSLATPDQQQYDEKNIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLNDIEELKAERLGLRNRIEKKTAYLQELEDQFVGLQNLIQRNERLYSSGNAPSGGVALPFILVQTRPHATVEVEISEDMQLVHFDFNSTPFKLHDDNSVLKAMKFCERQQSDDMAQSFPADDGEGSSMAGVYQPPQLLPPPRANNSNRPPTSPPVPGILKARVKHEH

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEECccccEEEEEEccccEEEEEECccccEEECccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****************************************************************************************************QFSMKVCEKVESKGRTTYNEVADELVA********************NIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLNDIEELKAERLGLRNRIEKKTAYLQELEDQFVGLQNLIQRNERLYSSGNAPSGGVALPFILVQTRPHATVEVEISEDMQLVHFDFNSTPFKLHDDNSVLKAMKFC***************************************************IL*AR*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVTGNNSHQEDGDRQQPAAKGGGATRSWGTTVSGQSVSTSGSVGSPSQSMATPASDSTFLRLNHLDIHGDDAGSQGAVVGGKKKKRGQRAGGGDKSGRGLRQFSMKVCEKVESKGRTTYNEVADELVAEFADPSNSLATPDQQQYDEKNIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLNDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSSGNAPSGGVALPFILVQTRPHATVEVEISEDMQLVHFDFNSTPFKLHDDNSVLKAMKFCERQQSDDMAQSFPADDGEGSSMAGVYQPPQLLPPPRANNSNRPPTSPPVPGILKARVKHEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor-like protein DPB	Involved in the regulation of the G1/S transition. Increases the DNA binding activity of E2F proteins after heterodimerization. The complex DPB/E2FC restricts cell division and lateral root initiation and may function as a negative regulator of E2F-regulated genes. The interaction with SKP2A is controlled by auxin.	probable	Q9FNY2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AZE, chain A
Confidence level:very confident
Coverage over the Query: 183-302
View the alignment between query and template
View the model in PyMOL

Template: 1CF7, chain B
Confidence level:very confident
Coverage over the Query: 97-180
View the alignment between query and template
View the model in PyMOL