Citrus Sinensis ID: 018864

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35

MMTTLSQTVSVFSNKAINLKSVASFNTIKTLRFNPPSSPRSLSRNFCRVQATILQDEEEKVVVEESSPLKNFPNDDEPPETGSASALEKWVIKFEQSVNILLTESVIMVLDALYRDRDYARFFVLETIARVPYFAFISVLHMYESFGWWRRADYLKVHFAESWNEMHHLLIMEELGGNAWWFDRFLAQHIAVAYYFVTVFMYVISPRMAYHFSECVESHAFETYDKFIKAQGEKLKKMPAPAVAIKYYTGGDLYLFDEFQTARLPNSRRPKIENLYDVFLNIRDDEAEHCKTMKACQTHGNLRSPHSYSEDDFGCEDESGCIVAQADCEGIVDCIKKAVAVSTPRVKQN

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccHHHHHHHHHHccEEEEcccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccccCCccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccc

**********VFSNKAINLKSVASFNTIK****************FCRVQATIL**************LKNFPNDDEPPETGSASALEKWVIKFEQSVNILLTESVIMVLDALYRDRDYARFFVLETIARVPYFAFISVLHMYESFGWWRRADYLKVHFAESWNEMHHLLIMEELGGNAWWFDRFLAQHIAVAYYFVTVFMYVISPRMAYHFSECVESHAFETYDKFIKAQGEKLKKMPAPAVAIKYYTGGDLYLFDEFQTARLPNSRRPKIENLYDVFLNIRDDEAEHCKTMKACQTHGNLRSPH*****DFG**DESGCIVAQADCEGIVDCIKKAV**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ubiquinol oxidase 4, chloroplastic/chromoplastic	Acts early in chloroplast biogenesis as a component of a redox chain responsible for phytoene desaturation. Involved in the differentiation of multiple plastid types, including chloroplasts, amyloplasts, and etioplasts. Might participate in the chloroplast respiratory chain.	confident	Q56X52

Prediction of Enzyme Commission Number

No confident prediction of EC number!