Citrus Sinensis ID: 018874

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MSYSRDSSENVVHIIVGNGAPEHWIPNPNDSSVWATEDDYPDDPPSISNSNCQSQTRSNSEQPPNKKSRNGSQDVNSKSKAIGKMFFKTKLCCKFRNGTCPYITNCNFAHSIEELRRPPPNWQEIVAAHEEERASTNEIPREEFQIPSIVSTNFAVETQRSYKGRHCKKFYTEEGCPYGENCTFLHDEQSKNRESVAISLGPGGYGGGGAAAAAAGNNIGVSNVKPSNWKTRICNKWELTGYCPFGNKCHFAHGIQELHRFGGGLVESENNDSSAAPSDSKLVGVPSKTPVDTVVASVTSVPHADVYHMGVPSQRSSIVVQRPGQRSHEKWKGPDKISRIYGDWIDDIE
cccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
**********VVHIIVGNGAPEHWI*********************************************************GKMFFKTKLCCKFRNGTCPYITNCNFAHSIEELRRPPPNWQEIVAAHEEERASTNEIPREEFQIPSIVSTNFAVETQRSYKGRHCKKFYTEEGCPYGENCTFLHDEQSKNRESVAISLGPGGYGGGGAAAAAAGNNIGVSNVKPSNWKTRICNKWELTGYCPFGNKCHFAHGIQELHR****************************************************************************ISRIYGDWIDDI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSRDSSENVVHIIVGNGAPEHWIPNPNDSSVWATEDDYPDDPPSISNSNCQSQTRSNSEQPPNKKSRNGSQDVNSKSKAIGKMFFKTKLCCKFRNGTCPYITNCNFAHSIEELRRPPPNWQEIVAAHEEERASTNEIPREEFQIPSIVSTNFAVETQRSYKGRHCKKFYTEEGCPYGENCTFLHDEQSKNRESVAISLGPGGYGGGGAAAAAAGNNIGVSNVKPSNWKTRICNKWELTGYCPFGNKCHFAHGIQELHRFGGGLVESENNDSSAAPSDSKLVGVPSKTPVDTVVASVTSVPHADVYHMGVPSQRSSIVVQRPGQRSHEKWKGPDKISRIYGDWIDDIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 56 probableQ84UQ3
Zinc finger CCCH domain-containing protein 12 probableQ9LQM3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 83-119
View the alignment between query and template
View the model in PyMOL
Template: 1M9O, chain A
Confidence level:very confident
Coverage over the Query: 160-194,224
View the alignment between query and template
View the model in PyMOL
Template: 3U9G, chain A
Confidence level:confident
Coverage over the Query: 89-186,233-257
View the alignment between query and template
View the model in PyMOL