Citrus Sinensis ID: 018877


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MVIYIIRSNWMWCCLQTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEITSADMFEDASA
ccHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHHHccccccEEEEEccccccccHHHHHHHHcccccccccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEcccHHHccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEccCEEEEccEEccccHHHHHHHHHHcccEEEEEEEccccccccccEEccccccccccEEEEEEEEccccccccEEEEEcccccccccccEEEEEccccccccccccEEcccccccccccccccccHHHccc
*VIYIIRSNWMWCCLQTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVK*****************SLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNL***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIYIIRSNWMWCCLQTFAEGVVSKLKLDSHILQDSIIKEVNENPKAGWKAARNPQFSNYTVGQFKHLLGVKPTPKGLLLGVPVKTHDKSLKLPKSFDARSAWPQCSTISRILDQGHCGSCWAFGAVEALSDRFCIHFGMNLSLSVNDLLACCGFLCGDGCDGGYPISAWRYFVHHGVVTEECDPYFDSTGCSHPGCEPAYPTPKCVRKCVKKNQLWRNSKHYSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKSGVYKHITGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEITSADMFEDASA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cathepsin B Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.probableP10605
Cathepsin B Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.probableQ5R6D1
Cathepsin B-like cysteine proteinase 6 probableP43510

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.22.-Cysteine endopeptidases.probable
3.4.22.1Transferred entry: 3.4.22.10.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HHI, chain A
Confidence level:very confident
Coverage over the Query: 78-330
View the alignment between query and template
View the model in PyMOL
Template: 3QJ3, chain A
Confidence level:very confident
Coverage over the Query: 6-190,208-328
View the alignment between query and template
View the model in PyMOL