Citrus Sinensis ID: 018894


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MSEGQKFQLGTVGALSLSVISSVSIVICNKALISSLGFTFATTLTSWHLLVTFCSLHVALWMKLFEHKPFDPRAVMGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTILLETLFFRKKFSRNIQLSLVILLVGVGIATVTDLQLNVLGSVLSLLAVLTTCVAQIMTNTIQKKFKVSSTQLLYQSCPYQALTLFIIGPFLDGLLTNKNVFAFKYTPYVLFFIVLSCLISVSVNFSTFLVIGKTSPVTYQVLGHLKTCLVLAFGYVLLHDPFSWRNILGILIAVIGMVLYSYCCSLESQQKASETSSQLPQVVKEGETDPLINAEKGTGDGVAKAPAWNSNKDLHA
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
*********GTVGALSLSVISSVSIVICNKALISSLGFTFATTLTSWHLLVTFCSLHVALWMKLFEHKPFDPRAVMGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTILLETLFFRKKFSRNIQLSLVILLVGVGIATVTDLQLNVLGSVLSLLAVLTTCVAQIMTNTIQKKFKVSSTQLLYQSCPYQALTLFIIGPFLDGLLTNKNVFAFKYTPYVLFFIVLSCLISVSVNFSTFLVIGKTSPVTYQVLGHLKTCLVLAFGYVLLHDPFSWRNILGILIAVIGMVLYSYCCSL**************************************************
xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHxxxHxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEGQKFQLGTVGALSLSVISSVSIVICNKALISSLGFTFATTLTSWHLLVTFCSLHVALWMKLFEHKPFDPRAVMGFGVLNGISIGLLNLSLGFNSVGFYQMTKLAIIPCTILLETLFFRKKFSRNIQLSLVILLVGVGIATVTDLQLNVLGSVLSLLAVLTTCVAQIMTNTIQKKFKVSSTQLLYQSCPYQALTLFIIGPFLDGLLTNKNVFAFKYTPYVLFFIVLSCLISVSVNFSTFLVIGKTSPVTYQVLGHLKTCLVLAFGYVLLHDPFSWRNILGILIAVIGMVLYSYCCSLESQQKASETSSQLPQVVKEGETDPLINAEKGTGDGVAKAPAWNSNKDLHA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Uncharacterized membrane protein At1g06890 confidentQ8RXL8
Solute carrier family 35 member E3 Putative transporter.probableQ1JQ66
Solute carrier family 35 member E3 Putative transporter.probableA4IFK2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 77-144
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 235-296
View the alignment between query and template
View the model in PyMOL