Citrus Sinensis ID: 018896

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35

MAATMTPYQKLNLSHCFITKSCDFVLFWRPPSQGRTSFSSSAEVSSKKLQLVTASGSTSNNALPVSQSVPPITASKVKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHALTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPFWNFSAASYPDLEEKKRTGIFIPETNQSLNGNANVDTSSRGDVYPVEPYDDFSANQVLDAHWGILYDEDPSGLRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQVISNNL

ccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccCEEEEEEECccccHHHHHHHHHHcccccccEEEEEccccccEEEEEEEcccHHHHHHHHHHHccccEEEEECccccccEEEEEEEEEECcccccHHHHHHHHHHcccEEEECcccEEEEEEEccHHHHHHHHHHHccccEEEEEEEEEEEEEccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEEEECcccccHHHHHHHHHcccccccEEEEcc

*******YQKLNLSHCFITKSCDFVLFWR***********************************************VKRHTISVFVGDESGIINRIAGVFARRGYNIESLAVGLNVDKALFTIVVSGTERVLRQVVEQLNKLVNVIKVEDISNEPHVERELMLIKLNGDTSTWPEIMWLVDIFRAKVVDISEHALTIEVTGDPGKMVAVQRNLSKFGIKELARTGKIALRREKLGDTAPFWNFSAASYPDLE***R************************DVYPVEPYDDFSANQVLDAHWGILYDEDPSGLRSHTLSMLVNNTPGVLNIVTGVISRRGYNIQVISNNL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Acetolactate synthase small subunit 1, chloroplastic	Regulatory subunit of acetohydroxy-acid synthase. Involved in the feed-back inhibition by branched-chain amino acids but not in herbicide tolerance.	probable	Q9FFF4

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PC6, chain A
Confidence level:very confident
Coverage over the Query: 79-234
View the alignment between query and template
View the model in PyMOL

Template: 2FGC, chain A
Confidence level:very confident
Coverage over the Query: 312-348
View the alignment between query and template
View the model in PyMOL