Citrus Sinensis ID: 018951

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKGSLSPGGLLRGLSFKKKGIVSDGERSSLLSSDSQTSPGSPIIARITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
ccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccHHHcccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccEEEccccccccccHHHHccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHccccHHcHHcccccHHHHHHHHHHHHHHHHHHHHHccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccHHHHHEEEEcccccccccEEEccccccHHHHHHHHHHHHHHHHccccEEEEcccEEEcccEEEEEccccHHHHcccccccccccccccEcccccHHHHHHHHHHHHHHHHHHHHcccccHHHccccEEEEEcHHHHHHHHHHHHHHHHHccc
mqadieiegpsnaetsnpgpsgrrpdlslqvpprplgfvssrtgrpslqsqrsykgslspggllrglsfkkkgivsdgerssllssdsqtspgspiIARITSAfswqrctslpvtpasnlspsistpasartsgeqhkankgtaptavsrslsvpgrniVIVRSvslptrrdhvqtdtsddqivpapmenndeeiAEEEAVCRICLDICeegntlkmecSCKGALRLVHEECAIRWfstkgnkncevcgkevqnlpVTLLRMsssaqrdnrrnhsqqtmhsrsvsAWQDFVVLVLISTICYFFFLEQILVLpfryerklrkdnlmipicYNLSFLILILLYAIKTHLD
mqadieiegpsnaetsnpgpsgrrpdLSLQVPPRPLgfvssrtgrpslqsqrsykgslspggllrglsfKKKGIVsdgerssllssdsqtspgsPIIARITSAFSWQRCTSLpvtpasnlspsISTPASARTSgeqhkankgtaptavsrslsvpgrnivivrsvslptrrdhvqtdtsddqivpapMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFstkgnkncevcGKEVQNLPVTLLRMSSSAQRDNRRNhsqqtmhsrsvsAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKgslspggllrglsFKKKGIVsdgerssllssdsqtspgspIIARITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMenndeeiaeeeaVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
***********************************************************************************************IIARITSAFSWQRCTSL*********************************************NIVIVRS**********************************EAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLL***********************VSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKT***
**********************************************************************************************************************************************************************************************************RICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
***********************RPDLSLQVPPRPLGFVSSRT**************LSPGGLLRGLSFKKKGI*******************SPIIARITSAFSWQRCTSLPVTP********************************SRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMS*******************SVSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
************************************************************************************************************************************************************RNIVIVR*VSL**************************EIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSS****************RSVSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKGSLSPGGLLRGLSFKKKGIVSDGERSSLLSSDSQTSPGSPIIARITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTICYFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFLILILLYAIKTHLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query348 2.2.26 [Sep-21-2011]
Q86YJ5 346 E3 ubiquitin-protein liga yes no 0.367 0.369 0.263 1e-06
Q3TZ87 348 E3 ubiquitin-protein liga yes no 0.367 0.367 0.263 1e-06
Q0P496 421 E3 ubiquitin-protein liga no no 0.370 0.306 0.228 2e-06
A6P320398 E3 ubiquitin-protein liga no no 0.390 0.341 0.213 3e-06
Q8CBH7400 E3 ubiquitin-protein liga no no 0.390 0.34 0.213 3e-06
A6NNE9402 E3 ubiquitin-protein liga no no 0.390 0.338 0.206 1e-05
Q9P2E8 410 E3 ubiquitin-protein liga no no 0.379 0.321 0.219 2e-05
Q80TE3 409 E3 ubiquitin-protein liga no no 0.379 0.322 0.226 3e-05
P40318 1319 ERAD-associated E3 ubiqui yes no 0.175 0.046 0.309 0.0001
Q6ZQ89 909 E3 ubiquitin-protein liga no no 0.172 0.066 0.283 0.0002
>sp|Q86YJ5|MARH9_HUMAN E3 ubiquitin-protein ligase MARCH9 OS=Homo sapiens GN=MARCH9 PE=1 SV=2 Back     alignment and function desciption
 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 64/148 (43%), Gaps = 20/148 (13%)

Query: 202 CRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLPVTLLR 261
           CRIC    E+G  L   C C G++R  H+ C IRW S +G+ +CE+C  + Q L ++   
Sbjct: 110 CRICFQGPEQGELLS-PCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAIST-- 166

Query: 262 MSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTICYFFFLEQILVLPFRY---ERK 318
                     +N  Q    S +V        +VL S     F +  I  L +       K
Sbjct: 167 ----------KNPLQWQAISLTVIEKVQIAAIVLGS----LFLVASISWLIWSSLSPSAK 212

Query: 319 LRKDNLMIPICYNLSFLILILLYAIKTH 346
            ++ +L+  ICY +   + ++   +  H
Sbjct: 213 WQRQDLLFQICYGMYGFMDVVCIGLIIH 240
E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q3TZ87|MARH9_MOUSE E3 ubiquitin-protein ligase MARCH9 OS=Mus musculus GN=March9 PE=2 SV=1 Back     alignment and function description
>sp|Q0P496|MARH4_DANRE E3 ubiquitin-protein ligase MARCH4 OS=Danio rerio GN=march4 PE=2 SV=1 Back     alignment and function description
>sp|A6P320|MARHB_RAT E3 ubiquitin-protein ligase MARCH11 OS=Rattus norvegicus GN=March11 PE=1 SV=1 Back     alignment and function description
>sp|Q8CBH7|MARHB_MOUSE E3 ubiquitin-protein ligase MARCH11 OS=Mus musculus GN=March11 PE=2 SV=2 Back     alignment and function description
>sp|A6NNE9|MARHB_HUMAN E3 ubiquitin-protein ligase MARCH11 OS=Homo sapiens GN=MARCH11 PE=2 SV=3 Back     alignment and function description
>sp|Q9P2E8|MARH4_HUMAN E3 ubiquitin-protein ligase MARCH4 OS=Homo sapiens GN=MARCH4 PE=2 SV=2 Back     alignment and function description
>sp|Q80TE3|MARH4_MOUSE E3 ubiquitin-protein ligase MARCH4 OS=Mus musculus GN=March4 PE=2 SV=3 Back     alignment and function description
>sp|P40318|DOA10_YEAST ERAD-associated E3 ubiquitin-protein ligase DOA10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSM4 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZQ89|MARH6_MOUSE E3 ubiquitin-protein ligase MARCH6 OS=Mus musculus GN=March6 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query348
255551611441 protein binding protein, putative [Ricin 0.968 0.764 0.621 1e-115
225432416429 PREDICTED: uncharacterized protein LOC10 0.982 0.797 0.598 1e-111
356555575422 PREDICTED: uncharacterized protein LOC10 0.948 0.781 0.607 1e-107
449454458423 PREDICTED: uncharacterized protein LOC10 0.882 0.725 0.634 1e-101
224102537359 predicted protein [Populus trichocarpa] 0.928 0.899 0.579 8e-99
357447501424 E3 ubiquitin-protein ligase MARCH1 [Medi 0.951 0.780 0.574 2e-98
356546476410 PREDICTED: uncharacterized protein LOC10 0.816 0.692 0.608 3e-91
21594296424 unknown [Arabidopsis thaliana] 0.893 0.733 0.516 2e-74
145331984363 RING/U-box domain-containing protein [Ar 0.893 0.856 0.516 2e-74
18397535426 RING/U-box domain-containing protein [Ar 0.893 0.730 0.516 3e-74
>gi|255551611|ref|XP_002516851.1| protein binding protein, putative [Ricinus communis] gi|223543939|gb|EEF45465.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 217/349 (62%), Positives = 267/349 (76%), Gaps = 12/349 (3%)

Query: 1   MQADIEIEGPSNAETSNPGPSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKGSLSP 60
           MQAD+++  PSN E SNPGP+ +R DL +QVPPRP+GF  SR+G+  + SQ S KGS S 
Sbjct: 1   MQADLKLAEPSNGEISNPGPNTKRSDLLVQVPPRPVGFGPSRSGKGLMPSQNSCKGSSSS 60

Query: 61  GGLLRGLSFKKKGIVSDGERSSLLSSDSQTSPGSPIIARITSAFSWQRCTSLPVTPASNL 120
           GG LRGLSFKKKG V DGERS LL+SD +TSP SPI+A + SAFSWQRCTSLPVTPASNL
Sbjct: 61  GGFLRGLSFKKKGAVPDGERSFLLNSDPKTSPDSPIVASLRSAFSWQRCTSLPVTPASNL 120

Query: 121 SPSISTPASARTSGEQHKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSD 180
           SPS+STP SAR  GE  K +      AVSRSLSVPGRN+VIVRS S  + +++     ++
Sbjct: 121 SPSVSTPVSARLPGESIKTSG-----AVSRSLSVPGRNVVIVRSTSFASHKENNLVTPNE 175

Query: 181 DQIVPAPMENNDEEIAEEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTK 240
           DQI  +P+E +DEEI EEEAVCRICLD+C+EGN LKMECSCKGALRLVHEECAI+WFS K
Sbjct: 176 DQI-SSPVEVDDEEIPEEEAVCRICLDVCQEGNMLKMECSCKGALRLVHEECAIKWFSIK 234

Query: 241 GNKNCEVCGKEVQNLPVTLLRMSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTIC 300
           GNKNCEVCG+EV+NLPVTLLR++ SAQ +NR++ S Q   S ++SAWQDFVVLV+ISTIC
Sbjct: 235 GNKNCEVCGQEVKNLPVTLLRVTGSAQSNNRQDLSHQRFRSEAISAWQDFVVLVIISTIC 294

Query: 301 YFFFLEQILVLPFRYERKLRKDNLMIPICYNLSFL--ILILLYAIKTHL 347
           YFFFLEQ+L+   R +  +    +  P  + L  L  I  ++ AI+ ++
Sbjct: 295 YFFFLEQLLIHDMRTQAII----IAAPFAFTLGLLASIFAIILAIREYI 339

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225432416|ref|XP_002277762.1| PREDICTED: uncharacterized protein LOC100259554 [Vitis vinifera] gi|297736929|emb|CBI26130.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356555575|ref|XP_003546106.1| PREDICTED: uncharacterized protein LOC100527094 [Glycine max] Back     alignment and taxonomy information
>gi|449454458|ref|XP_004144971.1| PREDICTED: uncharacterized protein LOC101219420 [Cucumis sativus] gi|449470479|ref|XP_004152944.1| PREDICTED: uncharacterized protein LOC101219282 [Cucumis sativus] gi|449507660|ref|XP_004163094.1| PREDICTED: uncharacterized protein LOC101227905 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224102537|ref|XP_002312716.1| predicted protein [Populus trichocarpa] gi|222852536|gb|EEE90083.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357447501|ref|XP_003594026.1| E3 ubiquitin-protein ligase MARCH1 [Medicago truncatula] gi|355483074|gb|AES64277.1| E3 ubiquitin-protein ligase MARCH1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|356546476|ref|XP_003541652.1| PREDICTED: uncharacterized protein LOC100777100 [Glycine max] Back     alignment and taxonomy information
>gi|21594296|gb|AAM65991.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145331984|ref|NP_001078114.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|222423602|dbj|BAH19770.1| AT3G06330 [Arabidopsis thaliana] gi|332640856|gb|AEE74377.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18397535|ref|NP_566281.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|6437553|gb|AAF08580.1|AC011623_13 unknown protein [Arabidopsis thaliana] gi|16226607|gb|AAL16212.1|AF428443_1 AT3g06330/F24P17_21 [Arabidopsis thaliana] gi|22137116|gb|AAM91403.1| At3g06330/F24P17_21 [Arabidopsis thaliana] gi|70905077|gb|AAZ14064.1| At3g06330 [Arabidopsis thaliana] gi|332640854|gb|AEE74375.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query348
TAIR|locus:2081076426 AT3G06330 [Arabidopsis thalian 0.893 0.730 0.452 2.6e-63
TAIR|locus:2144890411 AT5G18760 "AT5G18760" [Arabido 0.683 0.579 0.477 1.8e-60
TAIR|locus:2175158494 AT5G60580 [Arabidopsis thalian 0.560 0.394 0.399 4.9e-33
TAIR|locus:2075064491 AT3G09760 [Arabidopsis thalian 0.548 0.389 0.372 1.3e-27
TAIR|locus:2166399204 AT5G05830 [Arabidopsis thalian 0.295 0.504 0.356 1e-08
TAIR|locus:2065620207 AT2G37950 [Arabidopsis thalian 0.304 0.512 0.301 4.2e-08
TAIR|locus:2040949222 AT2G34200 [Arabidopsis thalian 0.247 0.387 0.314 2.8e-07
TAIR|locus:2150084206 AT5G01070 [Arabidopsis thalian 0.152 0.257 0.465 7.6e-07
TAIR|locus:2012477265 AT1G14260 [Arabidopsis thalian 0.146 0.192 0.442 1.1e-06
TAIR|locus:2154523231 AT5G59000 "AT5G59000" [Arabido 0.270 0.406 0.297 1.1e-06
TAIR|locus:2081076 AT3G06330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 646 (232.5 bits), Expect = 2.6e-63, P = 2.6e-63
 Identities = 148/327 (45%), Positives = 190/327 (58%)

Query:    20 PSGRRPDLSLQVPPRPLGFVSSRTGRPSLQSQRSYKXXXXXX--XXXXXXXFKKKGIVXX 77
             PS    DLS+Q+P R L F + R  + SL+S  S+K                KKK I   
Sbjct:    40 PSCSHLDLSIQIPSRSLPFGNGRNPKGSLKSTPSFKSGTTSSPRGILRNLSLKKKVISQP 99

Query:    78 XXXXXXXXXXXXXXXXXXIIAR-ITSAFSWQRCTSLPVTPASNLSPSISTPASARTSGEQ 136
                                 A   T++  W+RC SLP   A+ LSP +ST  SA   G+ 
Sbjct:   100 ESERSSLLSPGLMETAKKPNATGSTTSPYWKRCLSLPSRQAAKLSPVVSTQLSAGVPGDP 159

Query:   137 HKANKGTAPTAVSRSLSVPGRNIVIVRSVSLPTRRDHVQTDTSDDQIVPAPMXXXXXXXX 196
                NK       SRSLS+PGRN VIVRS+S    +  V ++TS DQ+   P         
Sbjct:   160 --PNKD-----YSRSLSMPGRNKVIVRSISFDNHKARVSSETSADQVSSVPPEETDEEIP 212

Query:   197 XXXXVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQNLP 256
                 VCRICLD+CEEGNTLKMECSCKG LRLVHE CA++WFSTKG + C+VC + VQNLP
Sbjct:   213 EEEAVCRICLDVCEEGNTLKMECSCKGDLRLVHEACAMKWFSTKGTRTCDVCRQVVQNLP 272

Query:   257 VTLLRMSSSAQRDNRRNHSQQTMHSRSVSAWQDFVVLVLISTICYFFFLEQILVLPFRYE 316
             VTL+R+ +  Q++NRR  SQQ M S++VSAWQ+FVVLVLIST+CYFFFLEQ+L+      
Sbjct:   273 VTLVRVPTPNQQNNRRGSSQQNMPSQTVSAWQEFVVLVLISTVCYFFFLEQLLI------ 326

Query:   317 RKLRKDNLMIPICYNLSFLILILLYAI 343
             R L K  + I   ++L+  +L  ++AI
Sbjct:   327 RDLNKQAIYIAAPFSLTLGLLASIFAI 353
GO:0005737 "cytoplasm" evidence=ISM
GO:0005794 "Golgi apparatus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
TAIR|locus:2144890 AT5G18760 "AT5G18760" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175158 AT5G60580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075064 AT3G09760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166399 AT5G05830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065620 AT2G37950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040949 AT2G34200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150084 AT5G01070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2012477 AT1G14260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154523 AT5G59000 "AT5G59000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 3e-19
pfam1290647 pfam12906, RINGv, RING-variant domain 9e-18
COG5183 1175 COG5183, SSM4, Protein involved in mRNA turnover a 1e-09
PHA02825162 PHA02825, PHA02825, LAP/PHD finger-like protein; P 1e-06
PHA02862156 PHA02862, PHA02862, 5L protein; Provisional 1e-04
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
 Score = 79.6 bits (197), Expect = 3e-19
 Identities = 25/49 (51%), Positives = 33/49 (67%)

Query: 201 VCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCG 249
           +CRIC D  +EG+ L   C CKG+L+ VH+EC  RW +  GNK CE+C 
Sbjct: 1   ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK 49

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Classical RING domain: C-x (2) -C-x (9-39)-C-x(1-3)-H-x(2-3)-C-x(2)-C-x(4-48) -C-x(2)-C. Length = 49
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227510 COG5183, SSM4, Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|177491 PHA02825, PHA02825, LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165197 PHA02862, PHA02862, 5L protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 348
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 99.68
PHA02825162 LAP/PHD finger-like protein; Provisional 99.66
PHA02862156 5L protein; Provisional 99.62
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 99.62
KOG1609323 consensus Protein involved in mRNA turnover and st 99.61
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 99.56
KOG3053 293 consensus Uncharacterized conserved protein [Funct 99.48
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 97.99
PHA02929238 N1R/p28-like protein; Provisional 97.65
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.52
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.43
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.29
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.23
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.22
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 97.09
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.0
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.91
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.75
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 96.7
KOG149384 consensus Anaphase-promoting complex (APC), subuni 96.5
PHA02926242 zinc finger-like protein; Provisional 96.42
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 96.36
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 96.3
COG52191525 Uncharacterized conserved protein, contains RING Z 95.89
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 95.81
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.41
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 95.37
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 95.2
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 95.15
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 94.44
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.37
PF1463444 zf-RING_5: zinc-RING finger domain 94.36
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.08
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 92.52
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 91.63
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 90.16
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 89.48
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 89.23
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 89.2
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 88.99
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 88.16
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 87.7
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 87.06
KOG0825 1134 consensus PHD Zn-finger protein [General function 86.81
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 83.61
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 83.15
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 82.95
KOG4445368 consensus Uncharacterized conserved protein, conta 82.9
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 82.64
PLN02195 977 cellulose synthase A 81.82
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 81.5
COG5175 480 MOT2 Transcriptional repressor [Transcription] 81.1
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 80.38
PLN02436 1094 cellulose synthase A 80.31
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information 
Probab=99.68  E-value=1.8e-17  Score=121.36  Aligned_cols=49  Identities=51%  Similarity=1.187  Sum_probs=45.7

Q ss_pred             eeEEeccCCCCCCeeeccCcccCcccccCHHHHHHHHHHcCCccccccC
Q 018951          201 VCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCG  249 (348)
Q Consensus       201 ~CRICl~~~eeg~~Li~PC~CkGslk~VH~~CL~kWl~~k~~~~CElCk  249 (348)
                      +||||++.+++++++++||.|+|+++|||++||.+|+..+++.+||+|+
T Consensus         1 ~CrIC~~~~~~~~~l~~PC~C~G~~~~vH~~Cl~~W~~~~~~~~C~iC~   49 (49)
T smart00744        1 ICRICHDEGDEGDPLVSPCRCKGSLKYVHQECLERWINESGNKTCEICK   49 (49)
T ss_pred             CccCCCCCCCCCCeeEeccccCCchhHHHHHHHHHHHHHcCCCcCCCCC
Confidence            5999999666778999999999999999999999999999999999996

Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity. The RING-variant domain is reminiscent of both the RING and the PHD domains and may represent an evolutionary intermediate. To describe this domain the term PHD/LAP domain has been used in the past. Extended description: The RING-variant (RINGv) domain contains a C4HC3 zinc-finger-like motif similar to the PHD domain, while some of the spacing between the Cys/His residues follow a pattern somewhat closer to that found in the RING domain. The RINGv domain, similar to the RING, PHD and LIM domains, is thought to bind two zinc ions co-ordinated by the highly conserved Cys and His residues. RING variant domain: C-x (2) -C-x(10-45)-C-x (1) -C-x (7) -H-x(2)-C-x(11-25)-C-x(2)-C As opposed to a PHD: C-x(1-2) -C-x (7-13)-C-x(2-4)-C-x(4-5)-H-x(2)-C-x(10-21)-C-x(2)-C Class
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query348
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 4e-20
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 1e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 2e-05
3nw0_A238 Non-structural maintenance of chromosomes element 2e-04
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
 Score = 81.7 bits (202), Expect = 4e-20
 Identities = 20/55 (36%), Positives = 24/55 (43%), Gaps = 2/55 (3%)

Query: 197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKE 251
           E+  VC IC    E GN     C C G L  VH  C   W +   N  C++CG  
Sbjct: 4   EDVPVCWICN--EELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVV 56
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query348
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.74
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.69
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.46
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.36
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.32
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.28
2ect_A78 Ring finger protein 126; metal binding protein, st 98.2
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.19
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.19
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.18
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.15
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.15
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.02
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.99
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.98
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 97.97
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.95
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.9
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.88
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 97.88
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.85
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 97.84
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.83
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.8
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 97.77
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.75
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.72
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 97.7
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 97.68
2ysj_A63 Tripartite motif-containing protein 31; ring-type 97.67
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 97.64
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.64
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 97.54
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.49
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.46
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 97.38
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.35
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.3
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.23
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 97.19
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.19
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.16
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.03
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.94
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 96.87
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.85
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.83
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 96.8
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 96.74
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.66
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.49
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.46
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.23
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 96.16
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 96.0
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 95.88
2ea5_A68 Cell growth regulator with ring finger domain prot 95.72
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 95.7
3nw0_A238 Non-structural maintenance of chromosomes element 95.7
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 95.58
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.11
2f42_A179 STIP1 homology and U-box containing protein 1; cha 94.74
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 94.63
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 94.52
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 94.39
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 93.25
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 92.72
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 91.51
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 90.54
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 89.05
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 84.4
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 81.79
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
Probab=99.74  E-value=6e-19  Score=132.39  Aligned_cols=56  Identities=34%  Similarity=0.789  Sum_probs=50.5

Q ss_pred             CCCCeeEEeccCCCCCCeeeccCcccCcccccCHHHHHHHHHHcCCccccccCceeec
Q 018951          197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQN  254 (348)
Q Consensus       197 eee~~CRICl~~~eeg~~Li~PC~CkGslk~VH~~CL~kWl~~k~~~~CElCk~~y~~  254 (348)
                      +++..||||+++.  ++++++||+|+|++++||+.||.+|+.++++.+||+|+++|+.
T Consensus         4 ~~~~~CrIC~~~~--~~~l~~PC~C~gs~~~~H~~Cl~~W~~~~~~~~C~~C~~~~~~   59 (60)
T 1vyx_A            4 EDVPVCWICNEEL--GNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEEC--SCCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCEeEEeecCC--CCceecCcCCCCchhhhHHHHHHHHHHhCCCCccCCCCCeeec
Confidence            5678999999863  4568999999999999999999999999999999999999974
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 348
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 9e-10
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 5e-06
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-04
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

 Score = 51.8 bits (123), Expect = 9e-10
 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQ 253
           E+  VC IC +  E GN     C C G L  VH  C   W +   N  C++CG    
Sbjct: 4   EDVPVCWICNE--ELGNERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYN 58
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query348
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.52
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.42
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.29
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.24
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.18
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.07
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.99
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 97.31
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 97.3
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.1
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 96.97
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 95.85
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 95.7
d2c2la280 STIP1 homology and U box-containing protein 1, STU 95.36
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 95.2
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 94.94
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 87.29
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.65
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 84.22
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: Variant RING domain
domain: IE1B protein (ORF K3), N-terminal domain
species: Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]

Probab=99.52  E-value=2.6e-15  Score=109.75  Aligned_cols=56  Identities=32%  Similarity=0.745  Sum_probs=50.2

Q ss_pred             CCCCeeEEeccCCCCCCeeeccCcccCcccccCHHHHHHHHHHcCCccccccCceeec
Q 018951          197 EEEAVCRICLDICEEGNTLKMECSCKGALRLVHEECAIRWFSTKGNKNCEVCGKEVQN  254 (348)
Q Consensus       197 eee~~CRICl~~~eeg~~Li~PC~CkGslk~VH~~CL~kWl~~k~~~~CElCk~~y~~  254 (348)
                      ++..+|+||+++.+  +.++.||.|+|..++||+.||.+|+..+++.+||+|+++|+.
T Consensus         4 ed~~~C~IC~~~~~--~~~~~~c~c~~c~h~~H~~Cl~~W~~~~~~~~CP~Cr~~~~~   59 (60)
T d1vyxa_           4 EDVPVCWICNEELG--NERFRACGCTGELENVHRSCLSTWLTISRNTACQICGVVYNT   59 (60)
T ss_dssp             CSCCEETTTTEECS--CCCCCSCCCSSGGGSCCHHHHHHHHHHHTCSBCTTTCCBCCC
T ss_pred             CCCCCCccCCccCC--CceeEecccCCCCCEEcHHHHHHHHhhCCCCCCcccCCeeec
Confidence            56788999998643  467899999999999999999999999999999999999974
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure