Citrus Sinensis ID: 019012


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MMEQVENKQVIFRGYIEGAPKETDMEIKISGIQLKAPKGSDSGAFLVKNLYLSCDPYMRGRMRSSFTSSYIPPFVPGQPVEGFGVSKVVDSDNPNFKPGDLVAGLTGWEEYSLIRKTEQLRKIQPDHHIPLSYHIGLLGMPGFTAYAGFHEVCSPKSGEYVFVSAASGAVGQLVGQLAKLHGCYVVGSAGSSQKVDLLKNKLGFDEAFNYNDETDLVAALKRCFPQGIDIYFDNVGGEMLDAALLNMRDHGRIAVCGMVSLHSYHDPQGIHNLFTLVTKRITMKGFLQSDYLHLYPRFLDYVISNYKQGKIVYVEDMNEGLENAPAAFVGLFSGKNVGKQVVRVACE
ccccccccEEEEcccccccccccccEEEEEECccccccccccccEEEEEEEEEccccccccccccccccccccccccccEEccEEEEEEEccccccccccEEEEccccEEEEEEccccccEEccccccccHHHHccccccccHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccEEEcccccccHHHHHHHHccccccEEEcccccHHHHHHHHHHcccccEEEEccccccccccccccccHHHHHHccEEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEHHHHccccHHHHHHccccccccEEEEEEccc
****VENKQVIFRGYIEGAPKETDMEIKISGIQLKAPKGSDSGAFLVKNLYLSCDPYMRGRMRSSFTSSYIPPFVPGQPVEGFGVSKVVDSDNPNFKPGDLVAGLTGWEEYSLIRKTEQLRKIQPDHHIPLSYHIGLLGMPGFTAYAGFHEVCSPKSGEYVFVSAASGAVGQLVGQLAKLHGCYVVGSAGSSQKVDLLKNKLGFDEAFNYNDETDLVAALKRCFPQGIDIYFDNVGGEMLDAALLNMRDHGRIAVCGMVSLHSYHDPQGIHNLFTLVTKRITMKGFLQSDYLHLYPRFLDYVISNYKQGKIVYVEDMNEGLENAPAAFVGLFSGKNVGKQVVRVAC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMEQVENKQVIFRGYIEGAPKETDMEIKISGIQLKAPKGSDSGAFLVKNLYLSCDPYMRGRMRSSFTSSYIPPFVPGQPVEGFGVSKVVDSDNPNFKPGDLVAGLTGWEEYSLIRKTEQLRKIQPDHHIPLSYHIGLLGMPGFTAYAGFHEVCSPKSGEYVFVSAASGAVGQLVGQLAKLHGCYVVGSAGSSQKVDLLKNKLGFDEAFNYNDETDLVAALKRCFPQGIDIYFDNVGGEMLDAALLNMRDHGRIAVCGMVSLHSYHDPQGIHNLFTLVTKRITMKGFLQSDYLHLYPRFLDYVISNYKQGKIVYVEDMNEGLENAPAAFVGLFSGKNVGKQVVRVACE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative NADP-dependent oxidoreductase YfmJ Putative quinone oxidoreductase that may contribute to the degradation of aromatic compounds.probableO34812
Prostaglandin reductase 1 Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha. Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.probableP97584
Prostaglandin reductase 1 Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha (By similarity). Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.probableQ14914

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.3.-.-Acting on the CH-CH group of donors.probable
1.3.1.-10-hydroxytaxane O-acetyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3H, chain A
Confidence level:very confident
Coverage over the Query: 3-347
View the alignment between query and template
View the model in PyMOL