Citrus Sinensis ID: 019017


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------
MMKSYIWLQTADGSIQQVEQEVAMFCPLICQEVIQKGMGSSKNYAISLPQRVNPAMLSLILDYCRFHQVPGSSNKERKSFDEKFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKTPEEIREIFHLPDDLTEEEKLEPLKNTTDDPRIRLLNRLYAKKRKELKEREKLKNVESEEERVDERSVDDLLQFINGGERDSKGTKSSKNKKKNQRKKDQLKDTCPIESIKTDKQESNGLNFVCHSAEVGNKFSTDLGETSNMQNMEDGIFVRKVDFDDVDIDDEIDPALKEKLDREVEDFARRLNSDWPERMQEILSLGHDMKPLRHSTKGNGTIRRYANPERK
ccccEEEEEcccccEEEEcHHHHHHcHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccEEccccccccccccccccc
**KSYIWLQTADGSIQQVEQEVAMFCPLICQEVIQKGMGSSKNYAISLPQRVNPAMLSLILDYCRFHQVPGSSNKERKSFDEKFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKTPEEIREIFHLPDDLTEEEKLEP*****DDPRIRL******************************RSVDDLLQ***************************************************************************GIFVRKVDFDDVDIDDEIDPALKEKLDREVEDFARRLNSDWPERMQEI*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKSYIWLQTADGSIQQVEQEVAMFCPLICQEVIQKGMGSSKNYAISLPQRVNPAMLSLILDYCRFHQVPGSSNKERKSFDEKFIRMDTKRLCELTSAADSLQLKPLVDLTSRALARIIEGKTPEEIREIFHLPDDLTEEEKLEPLKNTTDDPRIRLxxxxxxxxxxxxxxxxxxxxxESEEERVDERSVDDLLQFINGGERDSKGTKSSKNKKKNQRKKDQLKDTCPIESIKTDKQESNGLNFVCHSAEVGNKFSTDLGETSNMQNMEDGIFVRKVDFDDVDIDDEIDPALKEKLDREVEDFARRLNSDWPERMQEILSLGHDMKPLRHSTKGNGTIRRYANPERK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SKP1-like protein 21 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends of the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1.confidentQ8LF97
SKP1-like protein 20 Involved in ubiquitination and subsequent proteasomal degradation of target proteins. Together with CUL1, RBX1 and a F-box protein, it forms a SCF E3 ubiquitin ligase complex. The functional specificity of this complex depends of the type of F-box protein. In the SCF complex, it serves as an adapter that links the F-box protein to CUL1.probableA8MQG7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1M, chain A
Confidence level:very confident
Coverage over the Query: 20-30,47-63,95-139
View the alignment between query and template
View the model in PyMOL