Citrus Sinensis ID: 019067
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| 224130382 | 356 | predicted protein [Populus trichocarpa] | 0.947 | 0.921 | 0.721 | 1e-138 | |
| 356560732 | 332 | PREDICTED: transcription factor ASG4 [Gl | 0.939 | 0.978 | 0.671 | 1e-126 | |
| 359489639 | 328 | PREDICTED: transcription factor ASG4-lik | 0.936 | 0.987 | 0.671 | 1e-125 | |
| 351723473 | 331 | MYB transcription factor MYB133 [Glycine | 0.936 | 0.978 | 0.640 | 1e-118 | |
| 224067932 | 257 | predicted protein [Populus trichocarpa] | 0.736 | 0.992 | 0.777 | 1e-114 | |
| 302398983 | 350 | MYBR domain class transcription factor [ | 0.913 | 0.902 | 0.664 | 1e-110 | |
| 157043074 | 318 | transcription factor 1R-MYB1 [Chimonanth | 0.875 | 0.952 | 0.625 | 1e-108 | |
| 149727871 | 333 | MYB transcription factor MYB40 [Medicago | 0.901 | 0.936 | 0.629 | 1e-108 | |
| 357504397 | 313 | MYB transcription factor MYB146 [Medicag | 0.768 | 0.849 | 0.704 | 1e-104 | |
| 356566919 | 307 | PREDICTED: transcription factor ASG4-lik | 0.867 | 0.977 | 0.573 | 1e-101 |
| >gi|224130382|ref|XP_002320823.1| predicted protein [Populus trichocarpa] gi|222861596|gb|EEE99138.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 496 bits (1278), Expect = e-138, Method: Compositional matrix adjust.
Identities = 241/334 (72%), Positives = 277/334 (82%), Gaps = 6/334 (1%)
Query: 1 MVSVNPNPAQGFFFFDPMN----MGHPGPNSLPPTGSYNAATTTNDSTTASASTKSTGAI 56
MVSVNPNPA GF+FFDPMN M PG N LPPT + A T ND+ +A+ +T +T
Sbjct: 1 MVSVNPNPALGFYFFDPMNNSSHMELPGVNFLPPTNTNTATDTCNDTVSAANTTTTTNNN 60
Query: 57 --NTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVI 114
+SF+EDP+KKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAF+GSKTVI
Sbjct: 61 NHKLVSFSEDPNKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFVGSKTVI 120
Query: 115 QIRSHAQKYFLKVQKNGTSEHVPPPRPKRKAAHPYPQKAPKTVHGVSQFGGQVQSSAALL 174
QIRSHAQKYFLKVQK+GTSEHVPPPRPKRKAAHPYPQKAPK+ SQ G QSS+ALL
Sbjct: 121 QIRSHAQKYFLKVQKSGTSEHVPPPRPKRKAAHPYPQKAPKSAAVASQVTGSFQSSSALL 180
Query: 175 EPGYIYRPDSSSVLGNPVPVAALSSWSYDSVPPVNVSQVTKDDVGLPGSSNAQNFCYSSS 234
EPGY+YRPDS+SVLGNP+ ALS+WS++SVPPV++SQ+T DD GL G + A CYSSS
Sbjct: 181 EPGYLYRPDSTSVLGNPITSGALSTWSFNSVPPVSMSQMTNDDAGLAGPTIANKCCYSSS 240
Query: 235 NDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPINFE 294
N+S RTW G+ ID+ GKP RVMPDFAQVYSF+G+VFDPN + H+QRLKQMDPIN E
Sbjct: 241 NESASRTWQTGKIIDKRAQGKPERVMPDFAQVYSFIGNVFDPNGSDHLQRLKQMDPINLE 300
Query: 295 TVLLLMRNLAINLTSPEFEDHKRLLSLYDVESER 328
TVLLLMRNL+INLTSPEFEDH+RLL+ YDV+SE+
Sbjct: 301 TVLLLMRNLSINLTSPEFEDHRRLLASYDVDSEK 334
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356560732|ref|XP_003548642.1| PREDICTED: transcription factor ASG4 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359489639|ref|XP_003633954.1| PREDICTED: transcription factor ASG4-like [Vitis vinifera] gi|297745319|emb|CBI40399.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351723473|ref|NP_001237536.1| MYB transcription factor MYB133 [Glycine max] gi|110931716|gb|ABH02857.1| MYB transcription factor MYB133 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224067932|ref|XP_002302605.1| predicted protein [Populus trichocarpa] gi|222844331|gb|EEE81878.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302398983|gb|ADL36786.1| MYBR domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|157043074|gb|ABV02070.1| transcription factor 1R-MYB1 [Chimonanthus praecox] | Back alignment and taxonomy information |
|---|
| >gi|149727871|gb|ABR28335.1| MYB transcription factor MYB40 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357504397|ref|XP_003622487.1| MYB transcription factor MYB146 [Medicago truncatula] gi|355497502|gb|AES78705.1| MYB transcription factor MYB146 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356566919|ref|XP_003551672.1| PREDICTED: transcription factor ASG4-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| TAIR|locus:2124928 | 303 | AT4G01280 [Arabidopsis thalian | 0.768 | 0.877 | 0.545 | 5.9e-76 | |
| TAIR|locus:2149589 | 331 | AT5G52660 [Arabidopsis thalian | 0.890 | 0.930 | 0.507 | 5.3e-72 | |
| TAIR|locus:2025411 | 287 | ASG4 "ALTERED SEED GERMINATION | 0.462 | 0.557 | 0.518 | 1.4e-70 | |
| TAIR|locus:2075049 | 298 | RVE8 "REVEILLE 8" [Arabidopsis | 0.786 | 0.912 | 0.477 | 1.2e-56 | |
| TAIR|locus:2151251 | 293 | LCL1 "LHY/CCA1-like 1" [Arabid | 0.713 | 0.843 | 0.492 | 4.9e-53 | |
| DICTYBASE|DDB_G0288783 | 423 | mybG "myb domain-containing pr | 0.205 | 0.167 | 0.774 | 3.6e-40 | |
| TAIR|locus:2167210 | 387 | RVE1 "REVEILLE 1" [Arabidopsis | 0.219 | 0.196 | 0.584 | 3.2e-23 | |
| TAIR|locus:2044345 | 608 | CCA1 "circadian clock associat | 0.234 | 0.133 | 0.555 | 4.5e-21 | |
| TAIR|locus:2169135 | 287 | RVE2 "REVEILLE 2" [Arabidopsis | 0.190 | 0.229 | 0.626 | 1.9e-19 | |
| TAIR|locus:2200970 | 645 | LHY "LATE ELONGATED HYPOCOTYL" | 0.213 | 0.114 | 0.581 | 4.3e-19 |
| TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 711 (255.3 bits), Expect = 5.9e-76, Sum P(2) = 5.9e-76
Identities = 150/275 (54%), Positives = 188/275 (68%)
Query: 54 GAINTMSFAEDPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTV 113
G +T+SF+EDP+ KIRKPYTI KSRE+WT+QEHDKFLEAL LFDRDWKKIEAF+GSKTV
Sbjct: 34 GRTSTVSFSEDPTTKIRKPYTIKKSRENWTDQEHDKFLEALHLFDRDWKKIEAFVGSKTV 93
Query: 114 IQIRSHAQKYFLKVQKNGTSEHVXXXXXXXXXXXXXXQKAPKTVHGVSQFGGQVQSSAAL 173
+QIRSHAQKYFLKVQK+G +EH+ KAPK V S S+ L
Sbjct: 94 VQIRSHAQKYFLKVQKSGANEHLPPPRPKRKASHPYPIKAPKNVAYTSL---PSSSTLPL 150
Query: 174 LEPGYIYRPDSSSVLGNPVPVAALSS-WSYDSVP-PVNVSQVTKDDVGLPGSSNAQNFCY 231
LEPGY+Y DS S++GN A+ SS W+++S P V +V + V N C
Sbjct: 151 LEPGYLYSSDSKSLMGNQAVCASTSSSWNHESTNLPKPVIEVEEPGVSATAPL-PNNRC- 208
Query: 232 SSSNDSTLRTWPVGETIDRGDHGKPRRVMPDFAQVYSFLGSVFDPNSTGHIQRLKQMDPI 291
+ T R V + + KP RVMP+FA+VYSF+GSVFDPN++GH+QRLKQMDPI
Sbjct: 209 --RQEDTERVRAVTKPNNEESCEKPHRVMPNFAEVYSFIGSVFDPNTSGHLQRLKQMDPI 266
Query: 292 NFETVLLLMRNLAINLTSPEFEDHKRLLSLYDVES 326
N ETVLLLM+NL++NLTSPEF + +RL+S Y ++
Sbjct: 267 NMETVLLLMQNLSVNLTSPEFAEQRRLISSYSAKA 301
|
|
| TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288783 mybG "myb domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200970 LHY "LATE ELONGATED HYPOCOTYL" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00140348 | hypothetical protein (356 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 3e-16 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 3e-11 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 3e-09 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-08 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 71.7 bits (176), Expect = 3e-16
Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
Query: 77 KSRESWTEQEHDKFLEALQLFDR-DW---KKI-EAFIGSK-TVIQIRSHAQKYFLKV 127
K R WTE HD+FL+A+Q DW K+I E + T Q+ SH QKY LK
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.59 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 99.54 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.51 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.18 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.16 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.07 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.91 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.82 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.72 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.7 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.52 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.44 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 98.42 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 98.3 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.29 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 98.28 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 97.63 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 97.62 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 96.92 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.85 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.46 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.41 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 96.32 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 95.98 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 95.91 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 95.29 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 95.03 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 94.81 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 94.19 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 93.93 | |
| PF11035 | 344 | SnAPC_2_like: Small nuclear RNA activating complex | 93.85 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 93.07 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 91.76 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 91.54 | |
| smart00426 | 68 | TEA TEA domain. | 91.48 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 91.17 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 90.78 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 90.76 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 90.05 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 90.04 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 88.2 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 85.97 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 84.95 | |
| PF01285 | 431 | TEA: TEA/ATTS domain family; InterPro: IPR000818 T | 84.24 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 83.73 |
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Probab=99.59 E-value=1.9e-15 Score=114.17 Aligned_cols=50 Identities=48% Similarity=0.727 Sum_probs=46.1
Q ss_pred cCCCCCCHHHHHHHHHHHHHcCc-hH---HHHHHHhC-CC-CHHHHHHHHHHHHHH
Q 019067 77 KSRESWTEQEHDKFLEALQLFDR-DW---KKIEAFIG-SK-TVIQIRSHAQKYFLK 126 (346)
Q Consensus 77 k~r~~WTeEEh~lFLeaLekyGr-dW---kkIA~~Vg-TR-T~~QcRSHaQKYF~k 126 (346)
|.|..||+|||.+||+||+.||+ +| ++|+++++ ++ |..||++|+||||++
T Consensus 1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k 56 (57)
T TIGR01557 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK 56 (57)
T ss_pred CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence 46789999999999999999998 99 99998776 67 999999999999986
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. |
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >smart00426 TEA TEA domain | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 346 | ||||
| 2cu7_A | 72 | Solution Structure Of The Sant Domain Of Human Kiaa | 2e-06 |
| >pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 1e-26 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 6e-20 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 7e-20 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 2e-15 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 8e-14 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 9e-14 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 6e-11 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 7e-10 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 9e-10 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 4e-07 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 7e-07 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 7e-06 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 1e-05 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
Score = 99.9 bits (249), Expect = 1e-26
Identities = 23/65 (35%), Positives = 36/65 (55%)
Query: 76 TKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTSEH 135
+ WT +E + F + L F R W KI IGS+TV+Q++S+A++YF K G +
Sbjct: 6 SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65
Query: 136 VPPPR 140
P +
Sbjct: 66 TPNQK 70
|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.67 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.66 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.63 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.54 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.51 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.45 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.43 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.4 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.39 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.39 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.37 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.33 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.32 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.32 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.3 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.96 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.26 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.26 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.22 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.17 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 99.14 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.14 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.14 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.1 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.09 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.08 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.08 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.07 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 99.05 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.01 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.01 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.0 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.96 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.93 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.91 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.91 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.86 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.85 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.82 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.82 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.8 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.72 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.72 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.6 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.5 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.68 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.58 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.34 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.26 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.98 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.36 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.06 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 95.02 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 95.66 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 95.17 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 93.59 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 93.14 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 90.18 | |
| 1ig6_A | 107 | MRF-2, modulator recognition factor 2; DNA binding | 89.78 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 87.74 | |
| 2hzd_A | 82 | Transcriptional enhancer factor TEF-1; DNA-binding | 86.53 |
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.67 E-value=5e-17 Score=128.02 Aligned_cols=61 Identities=28% Similarity=0.397 Sum_probs=56.7
Q ss_pred CCCCCCCCCcccccCCCCCCHHHHHHHHHHHHHcCchHHHHHHHhCCCCHHHHHHHHHHHH
Q 019067 64 DPSKKIRKPYTITKSRESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 124 (346)
Q Consensus 64 ~~~kKirkPy~i~k~r~~WTeEEh~lFLeaLekyGrdWkkIA~~VgTRT~~QcRSHaQKYF 124 (346)
.+.+|.++++.....+..||+|||++||++|++||++|.+||++|++||..|||.||++|+
T Consensus 3 sg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~ 63 (79)
T 2yus_A 3 SGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLP 63 (79)
T ss_dssp CSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSC
T ss_pred CcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhc
Confidence 3567889999988999999999999999999999999999999999999999999997763
|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 346 | ||||
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 5e-15 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 4e-14 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 4e-13 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-12 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 3e-11 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 5e-09 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 9e-07 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 1e-06 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 5e-05 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 9e-05 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 5e-04 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 66.5 bits (162), Expect = 5e-15
Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 5/58 (8%)
Query: 77 KSRESWTEQEHDKFLEALQLFDRDWKKIEA-----FIGSKTVIQIRSHAQKYFLKVQK 129
K R WT + H+KFL A+ + + + T + SH QK+ + ++K
Sbjct: 5 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK 62
|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.6 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.56 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.51 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.42 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.4 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.37 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.32 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.32 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.3 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.25 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.16 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.13 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.05 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.04 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.8 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.69 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.48 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.4 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 96.67 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 92.58 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 90.85 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 81.98 | |
| d1ig6a_ | 107 | MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta | 80.94 |
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: MYSM1 (KIAA1915) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60 E-value=9.6e-16 Score=113.08 Aligned_cols=54 Identities=41% Similarity=0.719 Sum_probs=50.5
Q ss_pred CCCCCHHHHHHHHHHHHHcCchHHHHHHHhCCCCHHHHHHHHHHHHHHHhhcCC
Q 019067 79 RESWTEQEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT 132 (346)
Q Consensus 79 r~~WTeEEh~lFLeaLekyGrdWkkIA~~VgTRT~~QcRSHaQKYF~kl~k~g~ 132 (346)
...||+||+++|+++|++||++|..||++|++||..||++||++|+.+..+.+.
T Consensus 2 ~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~~k~~~ 55 (65)
T d2cu7a1 2 SVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGL 55 (65)
T ss_dssp CCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCSCT
T ss_pred CCCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCC
Confidence 367999999999999999999999999999999999999999999999877654
|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|