Citrus Sinensis ID: 019078


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MLRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYANFTSKKDSSDALIRKESSTPKLSSTSNSKTQNATVLEQEGDDGTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPGSKDEAIFQ
ccccccEEEEEcccccccccEEEEEEccccEEEEEEcccccHHHHHHHccccccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHccccccccccEEEEEEEcccccccHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccHHHHccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccccccccEEEEccHHHcccHHHHHHHHHHHHHHccccccccccc
ccccccEEEEEcccccccccEEEEEEccccEEEEEEEccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHHcHHHHcccccccEEEEEEcccccccHHHHHHHccHEEEEEcccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccEEEEEEccccHHHccEEEEcHHHHHHccHHHHHHHHHHHHHHccccccccccc
mlresnilkfeknssvmrpgyyvgidprkKLVILGIRGTHTVYDLITDIVssgseevtfegysthfgTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFkelgfspdiVTAVAyatppcvsrelaesCSDYVTTVvmqddiiprlsptslRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYAnftskkdssdalirkesstpklsstsnsktqnatvleqegddgtvpeelfvpgTVYYLkrdvdtntrssdsrGREFFTLLkrhpgehfqKIILSgnlisahkcdNHLYALRDvtkglpgskdeaifq
mlresnilkfeknssvmrpgyyvgidpRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTtvvmqddiiprlsptslrrlrneilqtdwmsvvEKEDWKNVIDLVTNAKQVVSSVQDVARKLADyanftskkdssdalirkesstpklsstsnsktqnatvleqegddgtvpeELFVpgtvyylkrdvdtntrssdsrgREFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRdvtkglpgskdeaifq
MLRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIprlsptslrrlrNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYANFTSKKDSSDALIRkesstpklsstsnsktQNATVLEQEGDDGTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPGSKDEAIFQ
***************VMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYAN**********************************************ELFVPGTVYYLKRDV************EFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVT*************
*LRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQD**************************STPKLSSTSNSKTQNA*******DDGTVPEELFVPGTVYYLKRD*************EFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVT*************
MLRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYANFTS***************************NATVLEQEGDDGTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPGSKDEAIFQ
*LRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQD***************************************************GTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPG********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYANFTSKKDSSDALIRKESSTPKLSSTSNSKTQNATVLEQEGDDGTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLLKRHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPGSKDEAIFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query346 2.2.26 [Sep-21-2011]
P0C1S9668 Sn1-specific diacylglycer yes no 0.436 0.226 0.335 1e-10
Q91WC9669 Sn1-specific diacylglycer yes no 0.436 0.225 0.341 3e-10
Q6WQJ1 1044 Sn1-specific diacylglycer no no 0.511 0.169 0.279 7e-10
Q5YLM1 1044 Sn1-specific diacylglycer no no 0.511 0.169 0.279 7e-10
Q9Y4D2 1042 Sn1-specific diacylglycer yes no 0.511 0.169 0.279 7e-10
Q8NCG7672 Sn1-specific diacylglycer no no 0.436 0.224 0.329 1e-09
P61872392 Lipase OS=Rhizopus oryzae N/A no 0.436 0.385 0.278 2e-06
P61871392 Lipase OS=Rhizopus niveus N/A no 0.436 0.385 0.278 2e-06
O59952291 Lipase OS=Thermomyces lan N/A no 0.372 0.443 0.237 8e-05
P47145328 Putative lipase YJR107W O yes no 0.355 0.375 0.255 9e-05
>sp|P0C1S9|DGLB_RAT Sn1-specific diacylglycerol lipase beta OS=Rattus norvegicus GN=Daglb PE=1 SV=1 Back     alignment and function desciption
 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 93/167 (55%), Gaps = 16/167 (9%)

Query: 21  YYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSE----EVTFEGYSTHFGTAEAARWFL 76
           + V +D RK+ V++ +RGT ++ D++TD+ S+ SE    ++  +    H G A+AAR+  
Sbjct: 358 FIVVLDHRKESVVVAVRGTMSLQDVLTDL-SAESENLELDIELQDCVAHKGIAQAARYIY 416

Query: 77  NHEM--GTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAY 134
              +  G + Q       +RL +VGHSLG    +LLA+MLR       G  P  V A A+
Sbjct: 417 RRLVNDGILSQAFSVAPEYRLVVVGHSLGAGAAALLAIMLR-------GAYPQ-VRAYAF 468

Query: 135 ATP-PCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQT 180
           + P   +S+ L E   D+V ++++  D+IPRLS  ++  L+  IL+ 
Sbjct: 469 SPPRGLLSKSLFEYSKDFVVSLILGMDVIPRLSVANMEDLKRRILRV 515




Catalyzes the hydrolysis of diacylglycerol (DAG) to 2-arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. Required for axonal growth during development and for retrograde synaptic signaling at mature synapses.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q91WC9|DGLB_MOUSE Sn1-specific diacylglycerol lipase beta OS=Mus musculus GN=Daglb PE=1 SV=2 Back     alignment and function description
>sp|Q6WQJ1|DGLA_MOUSE Sn1-specific diacylglycerol lipase alpha OS=Mus musculus GN=Dagla PE=1 SV=2 Back     alignment and function description
>sp|Q5YLM1|DGLA_RAT Sn1-specific diacylglycerol lipase alpha OS=Rattus norvegicus GN=Dagla PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4D2|DGLA_HUMAN Sn1-specific diacylglycerol lipase alpha OS=Homo sapiens GN=DAGLA PE=1 SV=3 Back     alignment and function description
>sp|Q8NCG7|DGLB_HUMAN Sn1-specific diacylglycerol lipase beta OS=Homo sapiens GN=DAGLB PE=1 SV=2 Back     alignment and function description
>sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 Back     alignment and function description
>sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 Back     alignment and function description
>sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 Back     alignment and function description
>sp|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR107W PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
297744116 771 unnamed protein product [Vitis vinifera] 0.997 0.447 0.751 1e-152
224085619 505 predicted protein [Populus trichocarpa] 1.0 0.685 0.731 1e-151
255583226 499 triacylglycerol lipase, putative [Ricinu 1.0 0.693 0.741 1e-150
297827927 549 lipase class 3 family protein [Arabidops 0.968 0.610 0.650 1e-135
449462415 536 PREDICTED: uncharacterized protein LOC10 0.930 0.600 0.679 1e-132
4567316 508 hypothetical protein [Arabidopsis thalia 0.968 0.659 0.644 1e-132
42569869 546 alpha/beta-hydrolase domain-containing p 0.968 0.613 0.644 1e-132
356545839 705 PREDICTED: uncharacterized protein LOC10 0.947 0.465 0.674 1e-131
449507884 544 PREDICTED: uncharacterized protein LOC10 0.945 0.601 0.673 1e-129
297609994328 Os09g0571500 [Oryza sativa Japonica Grou 0.933 0.984 0.617 1e-117
>gi|297744116|emb|CBI37086.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 260/346 (75%), Positives = 295/346 (85%), Gaps = 1/346 (0%)

Query: 1   MLRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFE 60
           MLRESN+LKF KNSSVMRPGYY+GID RKKLVILGIRGTHTVYDLITD+V+S   EV+FE
Sbjct: 426 MLRESNVLKFVKNSSVMRPGYYIGIDTRKKLVILGIRGTHTVYDLITDVVTSSDGEVSFE 485

Query: 61  GYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFK 120
           GYSTHFGTAEAARWFLNHEMGT+R+CLE H+GFRLRLVGHSLGGA  SLLA+ML KKS +
Sbjct: 486 GYSTHFGTAEAARWFLNHEMGTLRKCLEKHEGFRLRLVGHSLGGATASLLAIMLHKKSRE 545

Query: 121 ELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIPRLSPTSLRRLRNEILQT 180
           ELGFSPDIV+A+ +AT PCVS+ELAESCSDYVTTVV+QDDIIPRLS  SL RLRNEI QT
Sbjct: 546 ELGFSPDIVSAIGFATSPCVSKELAESCSDYVTTVVVQDDIIPRLSVASLMRLRNEIAQT 605

Query: 181 DWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYANFTSKKDSSDALIRKESS-TP 239
           DWM+V+EKEDW++V+ LVTNAKQVV+SVQDVA KLADYA F S   SSD    KES+ TP
Sbjct: 606 DWMTVLEKEDWRSVMGLVTNAKQVVTSVQDVASKLADYAKFRSMTGSSDTRFGKESATTP 665

Query: 240 KLSSTSNSKTQNATVLEQEGDDGTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLL 299
            +SSTS    +N+ V+ +E     VPEELFVPGTVYYLKR+V+T + SS+S GREFFTL 
Sbjct: 666 SISSTSKRTAENSAVVRKEAAATKVPEELFVPGTVYYLKRNVETQSSSSNSEGREFFTLH 725

Query: 300 KRHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPGSKDEAIF 345
           +RHPGEHFQ+I+LS NLISAHKCD+H YALRDV KGLP S DE  F
Sbjct: 726 RRHPGEHFQRIVLSSNLISAHKCDSHYYALRDVLKGLPVSPDEGSF 771




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224085619|ref|XP_002307638.1| predicted protein [Populus trichocarpa] gi|222857087|gb|EEE94634.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255583226|ref|XP_002532378.1| triacylglycerol lipase, putative [Ricinus communis] gi|223527934|gb|EEF30021.1| triacylglycerol lipase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297827927|ref|XP_002881846.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata] gi|297327685|gb|EFH58105.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449462415|ref|XP_004148936.1| PREDICTED: uncharacterized protein LOC101216108 [Cucumis sativus] Back     alignment and taxonomy information
>gi|4567316|gb|AAD23727.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|42569869|ref|NP_181773.2| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] gi|330255027|gb|AEC10121.1| alpha/beta-hydrolase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356545839|ref|XP_003541341.1| PREDICTED: uncharacterized protein LOC100806156 [Glycine max] Back     alignment and taxonomy information
>gi|449507884|ref|XP_004163157.1| PREDICTED: uncharacterized protein LOC101223497 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297609994|ref|NP_001063994.2| Os09g0571500 [Oryza sativa Japonica Group] gi|52076096|dbj|BAD46609.1| unknown protein [Oryza sativa Japonica Group] gi|218202673|gb|EEC85100.1| hypothetical protein OsI_32476 [Oryza sativa Indica Group] gi|222642144|gb|EEE70276.1| hypothetical protein OsJ_30429 [Oryza sativa Japonica Group] gi|255679154|dbj|BAF25908.2| Os09g0571500 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
TAIR|locus:2053819546 AT2G42450 [Arabidopsis thalian 0.968 0.613 0.612 2e-111
TAIR|locus:2130000 654 AT4G16070 [Arabidopsis thalian 0.624 0.330 0.242 1.4e-15
TAIR|locus:505006344 642 AT3G14075 [Arabidopsis thalian 0.632 0.341 0.258 4.5e-14
DICTYBASE|DDB_G0291354938 DDB_G0291354 [Dictyostelium di 0.436 0.160 0.323 7.6e-13
TAIR|locus:2127048460 AT4G00500 [Arabidopsis thalian 0.447 0.336 0.289 7.7e-12
DICTYBASE|DDB_G0278621 856 DDB_G0278621 [Dictyostelium di 0.471 0.190 0.306 1.7e-10
RGD|1310193668 Daglb "diacylglycerol lipase, 0.384 0.199 0.328 6.3e-10
UNIPROTKB|P0C1S9668 Daglb "Sn1-specific diacylglyc 0.384 0.199 0.328 6.3e-10
DICTYBASE|DDB_G0289839826 DDB_G0289839 [Dictyostelium di 0.436 0.182 0.280 6.6e-10
UNIPROTKB|E1C5W7468 DAGLB "Uncharacterized protein 0.375 0.277 0.309 9.8e-10
TAIR|locus:2053819 AT2G42450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1100 (392.3 bits), Expect = 2.0e-111, P = 2.0e-111
 Identities = 212/346 (61%), Positives = 263/346 (76%)

Query:     1 MLRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFE 60
             MLRE+NILKF K+SSVMRPGYY+G+D R+KLV+ GIRGTHT+YDLITDIVSS  EEVTFE
Sbjct:   211 MLRENNILKFVKDSSVMRPGYYIGVDHRRKLVVFGIRGTHTIYDLITDIVSSSDEEVTFE 270

Query:    61 GYSTHFGTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFK 120
             GYSTHFGTAEAARWFLNHE+ TIR+CL  ++G++LRLVGHSLGGAI SL+A+ML+K   +
Sbjct:   271 GYSTHFGTAEAARWFLNHELQTIRRCLAKYEGYKLRLVGHSLGGAIASLMAIMLKKMPRE 330

Query:   121 ELGFSPDIVTAVAYATPPCVSRELAESCSDYVTTVVMQDDIIXXXXXXXXXXXXNEILQT 180
             ELGF  +I++AV YATPPCVS+ELAE+CS++VTT+VMQDDII            NEILQT
Sbjct:   331 ELGFDAEIISAVGYATPPCVSKELAENCSEFVTTIVMQDDIIPRLSAASLARLRNEILQT 390

Query:   181 DWMSVVEKEDWKNVIDLVTNAKQVVSSVQDVARKLADYANFTSKKDSSDALIRXXXXXXX 240
             DW SV+EKE+WKNV+DLVTNAKQVV+SVQDVARK++DYANF +KK+  +  I        
Sbjct:   391 DWTSVIEKEEWKNVLDLVTNAKQVVTSVQDVARKVSDYANFGNKKEVPE--IPSSKNNQS 448

Query:   241 XXXXXXXXXQNATVLEQEGDDGTVPEELFVPGTVYYLKRDVDTNTRSSDSRGREFFTLLK 300
                      ++   L         PEEL+VPG VYYL R +    +SS  +  E+++L K
Sbjct:   449 GILISDSTTKDVVKL---------PEELYVPGAVYYLMRSLRGTPKSSAGKQVEYYSLWK 499

Query:   301 RHPGEHFQKIILSGNLISAHKCDNHLYALRDVTKGLPGSKDEAIFQ 346
             R PG+HFQ+I+LSGN I+ HKCD+H YALRDV KG P   +E+IF+
Sbjct:   500 RDPGQHFQRILLSGNFITDHKCDSHYYALRDVLKGFPSFINESIFK 545




GO:0004806 "triglyceride lipase activity" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006629 "lipid metabolic process" evidence=IEA;ISS
TAIR|locus:2130000 AT4G16070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006344 AT3G14075 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291354 DDB_G0291354 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2127048 AT4G00500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278621 DDB_G0278621 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1310193 Daglb "diacylglycerol lipase, beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P0C1S9 Daglb "Sn1-specific diacylglycerol lipase beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289839 DDB_G0289839 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5W7 DAGLB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.V.1169.1
hypothetical protein (495 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
cd00519229 cd00519, Lipase_3, Lipase (class 3) 2e-39
pfam01764141 pfam01764, Lipase_3, Lipase (class 3) 9e-29
PLN02847 633 PLN02847, PLN02847, triacylglycerol lipase 1e-21
cd00741153 cd00741, Lipase, Lipase 3e-19
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 1e-04
>gnl|CDD|238287 cd00519, Lipase_3, Lipase (class 3) Back     alignment and domain information
 Score =  139 bits (351), Expect = 2e-39
 Identities = 48/169 (28%), Positives = 75/169 (44%), Gaps = 11/169 (6%)

Query: 9   KFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDI--VSSGSEEVTFEGYSTHF 66
           K  K         YV +D  +K +++  RGT ++ D +TD+       +     G   H 
Sbjct: 42  KLLKTDKQYDTQGYVAVDHDRKTIVIAFRGTVSLADWLTDLDFSPVPLDPPLCSGGKVHS 101

Query: 67  GTAEAARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSP 126
           G   A +   N  +  ++  L+ +  +++ + GHSLGGA+ SLLA+ LR +         
Sbjct: 102 GFYSAYKSLYNQVLPELKSALKQYPDYKIIVTGHSLGGALASLLALDLRLR------GPG 155

Query: 127 DIVTAVAYATPPCVSRELAE---SCSDYVTTVVMQDDIIPRLSPTSLRR 172
             VT   +  P   +   AE   S    V  VV  +DI+PRL P SL  
Sbjct: 156 SDVTVYTFGQPRVGNAAFAEYLESTKGRVYRVVHGNDIVPRLPPGSLTP 204


Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. . Length = 229

>gnl|CDD|216688 pfam01764, Lipase_3, Lipase (class 3) Back     alignment and domain information
>gnl|CDD|178439 PLN02847, PLN02847, triacylglycerol lipase Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
PLN02847 633 triacylglycerol lipase 100.0
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 100.0
PLN02934515 triacylglycerol lipase 99.97
PLN02454414 triacylglycerol lipase 99.97
PLN02802509 triacylglycerol lipase 99.97
PLN02324415 triacylglycerol lipase 99.97
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 99.97
PLN02310405 triacylglycerol lipase 99.97
PLN02571413 triacylglycerol lipase 99.96
PLN00413479 triacylglycerol lipase 99.96
PLN02162475 triacylglycerol lipase 99.96
PLN02408365 phospholipase A1 99.96
KOG4569336 consensus Predicted lipase [Lipid transport and me 99.96
PLN02719518 triacylglycerol lipase 99.96
PLN03037525 lipase class 3 family protein; Provisional 99.96
PLN02753531 triacylglycerol lipase 99.96
PLN02761527 lipase class 3 family protein 99.95
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.8
KOG2088596 consensus Predicted lipase/calmodulin-binding heat 99.75
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 99.48
KOG2088596 consensus Predicted lipase/calmodulin-binding heat 99.03
COG3675332 Predicted lipase [Lipid metabolism] 98.87
COG5153425 CVT17 Putative lipase essential for disintegration 98.64
KOG4540425 consensus Putative lipase essential for disintegra 98.64
COG3675332 Predicted lipase [Lipid metabolism] 98.12
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 97.19
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.59
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.44
COG2267298 PldB Lysophospholipase [Lipid metabolism] 96.39
KOG2564343 consensus Predicted acetyltransferases and hydrola 96.33
PRK10749330 lysophospholipase L2; Provisional 96.22
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 96.07
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 96.03
PHA02857276 monoglyceride lipase; Provisional 95.92
KOG1455313 consensus Lysophospholipase [Lipid transport and m 95.42
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 95.35
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 95.14
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 95.12
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.07
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 95.03
PLN02965255 Probable pheophorbidase 95.03
PLN02824294 hydrolase, alpha/beta fold family protein 95.02
PRK10985324 putative hydrolase; Provisional 95.02
PRK11071190 esterase YqiA; Provisional 94.98
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 94.85
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 94.84
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 94.82
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 94.82
PLN02298330 hydrolase, alpha/beta fold family protein 94.76
PLN02385349 hydrolase; alpha/beta fold family protein 94.63
PRK10673255 acyl-CoA esterase; Provisional 94.57
PLN02652395 hydrolase; alpha/beta fold family protein 94.5
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 94.4
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 94.24
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 94.07
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 94.03
TIGR03611257 RutD pyrimidine utilization protein D. This protei 93.96
PLN02211273 methyl indole-3-acetate methyltransferase 93.89
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 93.84
PRK00870302 haloalkane dehalogenase; Provisional 93.67
PLN02511388 hydrolase 93.66
PRK03204286 haloalkane dehalogenase; Provisional 93.62
PLN02442283 S-formylglutathione hydrolase 93.42
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 93.41
PRK10566249 esterase; Provisional 93.39
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 93.34
KOG3724 973 consensus Negative regulator of COPII vesicle form 93.3
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 92.95
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 92.55
COG3208244 GrsT Predicted thioesterase involved in non-riboso 92.54
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 92.52
PLN02894402 hydrolase, alpha/beta fold family protein 92.47
PRK03592295 haloalkane dehalogenase; Provisional 92.46
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 92.27
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 92.27
PRK13604307 luxD acyl transferase; Provisional 92.2
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 92.18
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 92.1
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 91.87
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 91.78
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 91.51
COG3319257 Thioesterase domains of type I polyketide synthase 91.4
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 91.35
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 91.27
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 91.26
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 91.17
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 90.93
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 90.91
PLN02679360 hydrolase, alpha/beta fold family protein 90.8
KOG3101283 consensus Esterase D [General function prediction 90.68
PRK10349256 carboxylesterase BioH; Provisional 90.57
PLN00021313 chlorophyllase 90.53
PRK11460232 putative hydrolase; Provisional 90.44
PRK08775343 homoserine O-acetyltransferase; Provisional 90.39
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 90.3
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 90.23
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 90.04
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 89.94
PRK10162318 acetyl esterase; Provisional 89.8
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 89.75
PLN02578354 hydrolase 89.74
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 89.61
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 89.47
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 89.37
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 89.36
KOG4372405 consensus Predicted alpha/beta hydrolase [General 89.07
PRK00175379 metX homoserine O-acetyltransferase; Provisional 88.72
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 88.7
PRK06489360 hypothetical protein; Provisional 88.11
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 87.87
PRK07581339 hypothetical protein; Validated 87.69
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 87.26
PF00091216 Tubulin: Tubulin/FtsZ family, GTPase domain; Inter 87.2
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 86.72
PRK06765389 homoserine O-acetyltransferase; Provisional 86.34
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 86.2
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 85.08
PRK05855 582 short chain dehydrogenase; Validated 84.99
COG0657312 Aes Esterase/lipase [Lipid metabolism] 84.98
COG1647243 Esterase/lipase [General function prediction only] 84.79
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 84.54
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 84.19
PF10503220 Esterase_phd: Esterase PHB depolymerase 83.95
PRK04940180 hypothetical protein; Provisional 83.78
PRK05077414 frsA fermentation/respiration switch protein; Revi 83.75
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 83.2
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 82.26
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 81.99
PLN03084383 alpha/beta hydrolase fold protein; Provisional 81.92
PLN02872395 triacylglycerol lipase 81.69
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 81.6
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 81.36
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 80.39
>PLN02847 triacylglycerol lipase Back     alignment and domain information
Probab=100.00  E-value=1.1e-49  Score=394.35  Aligned_cols=179  Identities=28%  Similarity=0.541  Sum_probs=160.1

Q ss_pred             CCccceeEEecCCCCCCceEEEEEeCCCCEEEEEEcCCCChhHHHHhccccCCCcc----------ccCCeeeeccHHHH
Q 019078            2 LRESNILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEV----------TFEGYSTHFGTAEA   71 (346)
Q Consensus         2 ~~~~di~~~~~~~~~~~~~~~v~~d~~~~~ivva~RGT~s~~D~~tDl~~~~~~~~----------~~~g~~vH~Gf~~a   71 (346)
                      ++++||++..++|++++|+|||++|+.++.|||+||||.|+.||+||+.+...+..          ...++++|+||+.+
T Consensus       150 i~~eDVL~~~~ks~i~kPaffVavDh~~K~IVVsIRGT~Si~D~LTDL~~~~vPf~~s~l~~gG~~n~~~G~AH~Gml~A  229 (633)
T PLN02847        150 FSQEDVLIQKPKAGILKPAFTIIRDENSKCFLLLIRGTHSIKDTLTAATGAVVPFHHSVLHDGGVSNLVLGYAHCGMVAA  229 (633)
T ss_pred             CCHHHEEEeecccccCCCCeEEEEeCCCCEEEEEECCCCCHHHHHHhcccccccCCcccccccCcccCcCCccCccHHHH
Confidence            67899999999999999999999999999999999999999999999987543210          11235799999999


Q ss_pred             HHHHHHHHHHHHHHHHHhcCCcEEEEeeeccchhHHHHHHHHHHhhcccccCCCCCeEEEEEecCCCCCCHHHHHhccCc
Q 019078           72 ARWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDY  151 (346)
Q Consensus        72 a~~~~~~~~~~l~~~l~~~~~~~l~vtGHSLGGavA~l~a~~l~~~~p~~~g~~~~~v~~~tfg~P~~~~~~~a~~~~~~  151 (346)
                      |+++++.+.+.|.+++.++|+|+|+|||||||||+|+|++++|+...    .+  ..++||+||+|+|++.+++++++.|
T Consensus       230 ArwI~~~i~~~L~kal~~~PdYkLVITGHSLGGGVAALLAilLRe~~----~f--ssi~CyAFgPp~cvS~eLAe~~k~f  303 (633)
T PLN02847        230 ARWIAKLSTPCLLKALDEYPDFKIKIVGHSLGGGTAALLTYILREQK----EF--SSTTCVTFAPAACMTWDLAESGKHF  303 (633)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCeEEEeccChHHHHHHHHHHHHhcCC----CC--CCceEEEecCchhcCHHHHHHhhhh
Confidence            99999999999999999999999999999999999999999998542    12  2578999999999999999999999


Q ss_pred             EeEEEeCCCCCCcCCccchhhhhhheeEecccccc
Q 019078          152 VTTVVMQDDIIPRLSPTSLRRLRNEILQTDWMSVV  186 (346)
Q Consensus       152 i~~iv~~~DiVPrlp~~~~~~l~~ei~~~~~~~~~  186 (346)
                      +++|||++|+||||+..++++||.||....|.+.+
T Consensus       304 VTSVVng~DIVPRLS~~Sl~dLR~EV~~~~W~~dl  338 (633)
T PLN02847        304 ITTIINGSDLVPTFSAASVDDLRSEVTASSWLNDL  338 (633)
T ss_pred             eEEEEeCCCCCccCCHHHHHHHHHHHhHhHHHHHH
Confidence            99999999999999999999999999888887643



>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG2088 consensus Predicted lipase/calmodulin-binding heat-shock protein [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>COG3675 Predicted lipase [Lipid metabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF00091 Tubulin: Tubulin/FtsZ family, GTPase domain; InterPro: IPR003008 This domain is found in all tubulin chains, as well as the bacterial FtsZ family of proteins Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
1tic_A269 Conformational Lability Of Lipases Observed In The 4e-06
1tia_A279 An Unusual Buried Polar Cluster In A Family Of Fung 2e-05
3o0d_A301 Crystal Structure Of Lip2 Lipase From Yarrowia Lipo 6e-05
3ngm_A319 Crystal Structure Of Lipase From Gibberella Zeae Le 2e-04
1dt3_A269 The Structural Origins Of Interfacial Activation In 6e-04
>pdb|1TIC|A Chain A, Conformational Lability Of Lipases Observed In The Absence Of An Oil-Water Interface: Crystallographic Studies Of Enzymes From The Fungi Humicola Lanuginosa And Rhizopus Delemar Length = 269 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 1/98 (1%) Query: 20 GYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHE 79 GY + D ++K + L RGT++ ITDIV + S+ +G H G + +N Sbjct: 65 GYVLRSD-KQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSYEQVVNDY 123 Query: 80 MGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKK 117 +++ L +H +++ + GHSLGGA L M L ++ Sbjct: 124 FPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQR 161
>pdb|1TIA|A Chain A, An Unusual Buried Polar Cluster In A Family Of Fungal Lipases Length = 279 Back     alignment and structure
>pdb|3O0D|A Chain A, Crystal Structure Of Lip2 Lipase From Yarrowia Lipolytica At 1.7 A Resolution Length = 301 Back     alignment and structure
>pdb|3NGM|A Chain A, Crystal Structure Of Lipase From Gibberella Zeae Length = 319 Back     alignment and structure
>pdb|1DT3|A Chain A, The Structural Origins Of Interfacial Activation In Thermomyces (Humicola) Lanuginosa Lipase Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 2e-27
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 1e-24
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 4e-21
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 4e-21
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 3e-20
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 1e-19
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 1e-17
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 3e-16
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 5e-14
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 7e-13
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 6e-04
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Length = 269 Back     alignment and structure
 Score =  107 bits (268), Expect = 2e-27
 Identities = 41/161 (25%), Positives = 68/161 (42%), Gaps = 6/161 (3%)

Query: 13  NSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAA 72
            S +     YV    ++K + L  RGT++    ITDIV + S+    +G   H G   + 
Sbjct: 57  TSLLSDTNGYVLRSDKQKTIYLVFRGTNSFRSAITDIVFNFSDYKPVKGAKVHAGFLSSY 116

Query: 73  RWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAV 132
              +N     +++ L +H  +++ + GHSLGGA   L  M L +   +E   SP  ++  
Sbjct: 117 EQVVNDYFPVVQEQLTAHPTYKVIVTGHSLGGAQALLAGMDLYQ---REPRLSPKNLSIF 173

Query: 133 AYATPPCVSRELAESCSDYVTT---VVMQDDIIPRLSPTSL 170
               P   +   A             V + DI+P + P S 
Sbjct: 174 TVGGPRVGNPTFAYYVESTGIPFQRTVHKRDIVPHVPPQSF 214


>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Length = 279 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Length = 258 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Length = 269 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Length = 319 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Length = 269 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Length = 261 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} Length = 301 Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Length = 279 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Length = 346 Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Length = 419 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 100.0
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 100.0
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 100.0
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 100.0
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 100.0
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 100.0
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 100.0
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 100.0
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 99.97
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 99.94
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 99.95
2qub_A 615 Extracellular lipase; beta roll, alpha/beta hydrol 97.44
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 96.56
3lp5_A250 Putative cell surface hydrolase; structural genom 96.43
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 96.33
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 96.23
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 96.14
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 96.12
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 96.1
2z8x_A 617 Lipase; beta roll, calcium binding protein, RTX pr 96.1
4fle_A202 Esterase; structural genomics, PSI-biology, northe 96.08
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.99
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 95.92
3h04_A275 Uncharacterized protein; protein with unknown func 95.9
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.85
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 95.76
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 95.74
3llc_A270 Putative hydrolase; structural genomics, joint cen 95.72
1iup_A282 META-cleavage product hydrolase; aromatic compound 95.69
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 95.68
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 95.66
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 95.65
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 95.61
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.58
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 95.57
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 95.57
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.55
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 95.55
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 95.54
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 95.53
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 95.49
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 95.47
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 95.47
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 95.46
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 95.46
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 95.45
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.43
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.43
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 95.36
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 95.35
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 95.35
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 95.35
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 95.35
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 95.33
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 95.32
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 95.31
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.31
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 95.31
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 95.29
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 95.29
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 95.29
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 95.27
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.26
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 95.23
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 95.2
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 95.18
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 95.18
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.17
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 95.16
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 95.13
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 95.13
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 95.1
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 95.1
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 95.08
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 95.07
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 95.06
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 95.05
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 95.04
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 95.03
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.02
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.0
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 95.0
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 94.99
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 94.98
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 94.97
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 94.97
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 94.97
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 94.95
1vkh_A273 Putative serine hydrolase; structural genomics, jo 94.93
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 94.92
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.89
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 94.89
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 94.88
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.87
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 94.86
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 94.84
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 94.82
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 94.8
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 94.8
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 94.78
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 94.77
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 94.75
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 94.74
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 94.73
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 94.68
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 94.67
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 94.67
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 94.64
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 94.62
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 94.61
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 94.6
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 94.59
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 94.59
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 94.56
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 94.55
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 94.54
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 94.49
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 94.42
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 94.38
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 94.37
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.37
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 94.32
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 94.3
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 94.28
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 94.21
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 94.2
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 94.12
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 94.09
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 94.04
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 93.99
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 93.96
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 93.92
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 93.91
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.9
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 93.87
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 93.82
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 93.75
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 93.68
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 93.66
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 93.63
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 93.63
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 93.62
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 93.62
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 93.52
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 93.5
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 93.49
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 93.49
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.43
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 93.32
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 93.3
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 93.3
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 93.13
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 93.02
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 93.02
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 93.02
3ain_A323 303AA long hypothetical esterase; carboxylesterase 93.0
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 92.99
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 92.97
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 92.91
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 92.86
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 92.84
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 92.78
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 92.74
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 92.71
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 92.63
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 92.57
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 91.69
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 92.47
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 92.46
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 92.34
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 92.24
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 92.09
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 92.06
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 91.97
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 91.96
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 91.95
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 91.94
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 91.93
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 91.92
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 91.92
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 91.9
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 91.9
3tej_A329 Enterobactin synthase component F; nonribosomal pe 91.88
1kez_A300 Erythronolide synthase; polyketide synthase, modul 91.88
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 91.82
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 91.8
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 91.78
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 91.77
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 91.68
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 91.64
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 91.57
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 91.56
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 91.37
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 91.23
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 91.22
3bjr_A283 Putative carboxylesterase; structural genomics, jo 91.11
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 91.01
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 91.01
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 90.95
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 90.93
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 90.87
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 90.83
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 90.8
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 90.8
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 90.71
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 90.46
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 90.43
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 90.28
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 89.98
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 89.85
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 89.8
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 89.63
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 89.29
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 89.21
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 89.03
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 88.87
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 88.75
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 88.32
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.08
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 87.6
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 87.35
3nuz_A398 Putative acetyl xylan esterase; structural genomic 87.23
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 87.12
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 86.81
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 86.6
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.54
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 85.39
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 85.26
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 84.91
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 84.72
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 84.37
3d59_A383 Platelet-activating factor acetylhydrolase; secret 84.29
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 83.94
3ryc_A451 Tubulin alpha chain; alpha-tubulin, beta-tubulin, 83.67
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.23
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 83.16
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 82.56
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 82.0
2btq_B426 Tubulin btubb; structural protein, cytoskeletal pr 81.78
3ryc_B445 Tubulin beta chain; alpha-tubulin, beta-tubulin, G 81.36
2bto_A473 Tubulin btuba; bacterial tubulin, polymerization, 81.13
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
Probab=100.00  E-value=5.5e-38  Score=290.65  Aligned_cols=202  Identities=15%  Similarity=0.142  Sum_probs=163.5

Q ss_pred             ceeEEecCCCCCCceEEEEEeCCCCEEEEEEcCCCChhHHHHhccccCCCcc-----ccCCeeeeccHHHHHHHHHHHHH
Q 019078            6 NILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEV-----TFEGYSTHFGTAEAARWFLNHEM   80 (346)
Q Consensus         6 di~~~~~~~~~~~~~~~v~~d~~~~~ivva~RGT~s~~D~~tDl~~~~~~~~-----~~~g~~vH~Gf~~aa~~~~~~~~   80 (346)
                      .++.... +...++.+||++|++++.|||+||||.++.||++|+.+......     ...+++||+||++++..+.+++.
T Consensus        33 ~iv~~f~-~~~~d~~gyva~d~~~~~IvVafRGT~s~~dw~~Dl~~~~~~~~~~g~~~~~~~~VH~GF~~~~~~~~~~~~  111 (258)
T 3g7n_A           33 TIVKRIY-DLVTDTNGFVGYSTEKKTIAVIMRGSTTITDFVNDIDIALITPELSGVTFPSDVKIMRGVHRPWSAVHDTII  111 (258)
T ss_dssp             EEEEEEE-ETTTTEEEEEEEETTTTEEEEEECCCSCCCC----CCCCEECCCCTTCCCCTTCCEEHHHHHHHHHHHHHHH
T ss_pred             EEEEEEe-cCCCCceEEEEEECCCCEEEEEECCCCCHHHHHHhcccceeccccCCCcCCCCcEEehhHHHHHHHHHHHHH
Confidence            3444443 56788999999999999999999999999999999998653210     13678999999999999999999


Q ss_pred             HHHHHHHHhcCCcEEEEeeeccchhHHHHHHHHHHhhcccccCCCCCeEEEEEecCCCCCCHHHHHhccC---cEeEEEe
Q 019078           81 GTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSD---YVTTVVM  157 (346)
Q Consensus        81 ~~l~~~l~~~~~~~l~vtGHSLGGavA~l~a~~l~~~~p~~~g~~~~~v~~~tfg~P~~~~~~~a~~~~~---~i~~iv~  157 (346)
                      +.|+++++++|+++|+|||||||||+|+|+|+++...+|.      ..+.+||||+||+||.+|+++++.   .+.||||
T Consensus       112 ~~l~~~~~~~p~~~i~vtGHSLGGalA~l~a~~l~~~~~~------~~v~~~tFg~PrvGn~~fa~~~~~~~~~~~Rvvn  185 (258)
T 3g7n_A          112 TEVKALIAKYPDYTLEAVGHSLGGALTSIAHVALAQNFPD------KSLVSNALNAFPIGNQAWADFGTAQAGTFNRGNN  185 (258)
T ss_dssp             HHHHHHHHHSTTCEEEEEEETHHHHHHHHHHHHHHHHCTT------SCEEEEEESCCCCBCHHHHHHHHHSSSEEEEEEE
T ss_pred             HHHHHHHHhCCCCeEEEeccCHHHHHHHHHHHHHHHhCCC------CceeEEEecCCCCCCHHHHHHHHhcCCCeEEEEe
Confidence            9999999999999999999999999999999999887542      358999999999999999998754   5789999


Q ss_pred             CCCCCCcCCcc---chhhhhhheeEeccccccccccceehhh----hhccccccchhhHHHHHHhhhhh
Q 019078          158 QDDIIPRLSPT---SLRRLRNEILQTDWMSVVEKEDWKNVID----LVTNAKQVVSSVQDVARKLADYA  219 (346)
Q Consensus       158 ~~DiVPrlp~~---~~~~l~~ei~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~si~~~~~~~~~~~  219 (346)
                      .+|+||+||+.   .+.|...|+|+...+.     .|++|.+    .|+++.....++.||..||++..
T Consensus       186 ~~D~VP~lPp~~~~gy~H~g~e~~~~~~~~-----~~~~C~~~ed~~Cs~~~~~~~~~~dH~~Yfg~~~  249 (258)
T 3g7n_A          186 VLDGVPNMYSSPLVNFKHYGTEYYSSGTEA-----STVKCEGQRDKSCSAGNGMYAVTPGHIASFGVVM  249 (258)
T ss_dssp             TTCBGGGTTCSTTTCCBCCSEEEEESSSST-----TCEECSSSSCTTTGGGSCCCBSCGGGGEETTEET
T ss_pred             CCCccCcCCCCCCcCCEecceEEEECCCCc-----eEEEeCCCCCCCccCcCCCCCcchHHHhHhcccc
Confidence            99999999972   3568999999865432     3555542    66676655678999999998754



>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2qub_A Extracellular lipase; beta roll, alpha/beta hydrolase, helical hairpin, hydrolase; 1.80A {Serratia marcescens} PDB: 2qua_A Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>2z8x_A Lipase; beta roll, calcium binding protein, RTX protein, hydrolase; 1.48A {Pseudomonas SP} PDB: 2zvd_A 3a6z_A 3a70_A* 2z8z_A 2zj6_A 2zj7_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>3ryc_A Tubulin alpha chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_A* 3ryh_A* 3ryi_A* 3ut5_A* 4eb6_A* 4f61_A* 4f6r_A* 3hke_A* 3hkc_A* 3hkd_A* 3hkb_A* 3n2g_A* 3n2k_A* 1sa0_A* 1sa1_A* 3edl_F* 1ffx_A* 1ia0_A* 2hxf_A* 2hxh_A* ... Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2btq_B Tubulin btubb; structural protein, cytoskeletal protein/complex, bacterial tubulin, cytoskeleton, polymerization, verrucomicrobia; HET: GDP; 3.2A {Prosthecobacter dejongeii} Back     alignment and structure
>3ryc_B Tubulin beta chain; alpha-tubulin, beta-tubulin, GTPase, microtubule, tubulin, cell cycle; HET: GTP GDP; 2.10A {Ovis aries} PDB: 3ryf_B* 3ryh_B* 3ryi_B* 3ut5_B* 4eb6_B* 4f6r_B* 4f61_B* 3hke_B* 3du7_B* 3e22_B* 3hkc_B* 3hkd_B* 3hkb_B* 3n2g_B* 3n2k_B* 1z2b_B* 2xrp_A* 4aqv_B* 4aqw_B* 4atu_A* ... Back     alignment and structure
>2bto_A Tubulin btuba; bacterial tubulin, polymerization, cytoskeleton, protein COM cytoskeletal protein; HET: GTP; 2.5A {Prosthecobacter dejongeii} SCOP: c.32.1.1 d.79.2.1 PDB: 2btq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 346
d3tgla_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor 2e-23
d1lgya_265 c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus ni 8e-23
d1tiba_269 c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces 2e-21
d1uwca_261 c.69.1.17 (A:) Feruloyl esterase A {Aspergillus ni 4e-19
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Length = 265 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Rhizomucor miehei [TaxId: 4839]
 Score = 95.6 bits (237), Expect = 2e-23
 Identities = 33/161 (20%), Positives = 61/161 (37%), Gaps = 6/161 (3%)

Query: 13  NSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAA 72
           ++ +      V     +K + +  RG+ ++ + I D+           G   H G  ++ 
Sbjct: 52  STLIYDTNAMVARGDSEKTIYIVFRGSSSIRNWIADLTFVPVSYPPVSGTKVHKGFLDSY 111

Query: 73  RWFLNHEMGTIRQCLESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAV 132
               N  + T+    + +  +++ + GHSLGGA V L A+ L +   +E G S   +   
Sbjct: 112 GEVQNELVATVLDQFKQYPSYKVAVTGHSLGGATVLLCALDLYQ---REEGLSSSNLFLY 168

Query: 133 AYATPPCVSRELAESCSDYVTTV---VMQDDIIPRLSPTSL 170
               P       A             V + DI+P L P + 
Sbjct: 169 TQGQPRVGDPAFANYVVSTGIPYRRTVNERDIVPHLPPAAF 209


>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Length = 265 Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Length = 269 Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Length = 261 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 100.0
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 100.0
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 100.0
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 100.0
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 100.0
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.68
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 96.37
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.1
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 95.94
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 95.76
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 95.33
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 95.16
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 95.09
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 95.08
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.05
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 95.05
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 94.88
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 94.82
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.68
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 94.65
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 94.55
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.3
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 94.29
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 94.26
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 94.18
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 94.17
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.09
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 94.06
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.98
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 93.91
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 93.9
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 93.89
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.83
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 93.66
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 93.58
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 93.58
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 93.45
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 93.17
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 92.94
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 92.57
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 92.01
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 91.85
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 90.97
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 90.85
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 90.81
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 90.63
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 89.55
d2btoa1244 Tubulin alpha-subunit {Prosthecobacter dejongeii [ 89.32
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 89.05
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 88.96
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 88.7
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 88.69
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 88.69
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 88.62
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 87.92
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 87.61
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 87.61
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 87.42
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 86.93
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 86.19
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 83.96
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 83.49
d1tubb1243 Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 982 83.16
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 83.1
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 82.8
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 82.62
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Fungal lipases
domain: Triacylglycerol lipase
species: Penicillium camembertii [TaxId: 5075]
Probab=100.00  E-value=5.1e-40  Score=304.10  Aligned_cols=206  Identities=19%  Similarity=0.258  Sum_probs=168.3

Q ss_pred             eeEEecCCCCCCceEEEEEeCCCCEEEEEEcCCCChhHHHHhccccCCCccccCCeeeeccHHHHHHHHHHHHHHHHHHH
Q 019078            7 ILKFEKNSSVMRPGYYVGIDPRKKLVILGIRGTHTVYDLITDIVSSGSEEVTFEGYSTHFGTAEAARWFLNHEMGTIRQC   86 (346)
Q Consensus         7 i~~~~~~~~~~~~~~~v~~d~~~~~ivva~RGT~s~~D~~tDl~~~~~~~~~~~g~~vH~Gf~~aa~~~~~~~~~~l~~~   86 (346)
                      ++....++...++.+||++|++++.|||+||||.++.||++|+.+.......+.|++||+||+.++..+++++.+.|+++
T Consensus        51 ~~~~~~~~~~~~~~gyva~d~~~k~IvvafRGT~s~~d~~~Dl~~~~~~~~~~~~~~vH~GF~~~~~~~~~~i~~~i~~~  130 (271)
T d1tiaa_          51 VSYDFSDSTITDTAGYIAVDHTNSAVVLAFRGSYSVRNWVADATFVHTNPGLCDGCLAELGFWSSWKLVRDDIIKELKEV  130 (271)
T ss_pred             EEEEEecCCccCccEEEEEeCCCCEEEEEECCCCCHHHHHHhhhcccccCCCCCCcEEeHHHHHHHHHHHHHHHHHHHHH
Confidence            34445567788899999999999999999999999999999999876554556789999999999999999999999999


Q ss_pred             HHhcCCcEEEEeeeccchhHHHHHHHHHHhhcccccCCCCCeEEEEEecCCCCCCHHHHHhccCc--EeEEEeCCCCCCc
Q 019078           87 LESHKGFRLRLVGHSLGGAIVSLLAMMLRKKSFKELGFSPDIVTAVAYATPPCVSRELAESCSDY--VTTVVMQDDIIPR  164 (346)
Q Consensus        87 l~~~~~~~l~vtGHSLGGavA~l~a~~l~~~~p~~~g~~~~~v~~~tfg~P~~~~~~~a~~~~~~--i~~iv~~~DiVPr  164 (346)
                      +.++|+++|+|||||||||+|+|+|++|+..     +.+  .++|||||+||+||.+|+++++..  ..||||.+|+|||
T Consensus       131 ~~~~~~~~i~iTGHSLGGAlA~L~a~~l~~~-----~~~--~~~~~tfG~PrvGn~~fa~~~~~~~~~~Rvv~~~D~VP~  203 (271)
T d1tiaa_         131 VAQNPNYELVVVGHSLGAAVATLAATDLRGK-----GYP--SAKLYAYASPRVGNAALAKYITAQGNNFRFTHTNDPVPK  203 (271)
T ss_pred             HHhCCCceEEEeccchHHHHHHHHHHHHHHc-----CCC--cceEEEeCCCCcCCHHHHHHHHhcCCeeEEEECCCEEEE
Confidence            9999999999999999999999999999765     222  478999999999999999988653  5799999999999


Q ss_pred             CCccch--hhhhhheeEecccccc-ccccceehhh----hhccc--cccchhhHHHHHHhhhhh
Q 019078          165 LSPTSL--RRLRNEILQTDWMSVV-EKEDWKNVID----LVTNA--KQVVSSVQDVARKLADYA  219 (346)
Q Consensus       165 lp~~~~--~~l~~ei~~~~~~~~~-~~~~~~~~~~----~~~~~--~~~~~si~~~~~~~~~~~  219 (346)
                      ||+..+  .|...|+|+....... ...+++.|.+    .|.++  .....++.||..||+...
T Consensus       204 lP~~~~gy~H~~~ev~~~~~~~~~~~~~~~~~c~g~~~~~~~~~~~~~~~~~~~dH~~Yf~~~~  267 (271)
T d1tiaa_         204 LPLLSMGYVHVSPEYWITSPNNATVSTSDIKVIDGDVSFDGNTGTGLPLLTDFEAHIWYFVQVD  267 (271)
T ss_pred             CCCCCCCCEecCeEEEEcCCCCcccCCCCeEEeCCCCCCCCCCCcccccCCccHHHHhheeeCC
Confidence            999874  6899999986543321 2234555542    22222  234457899999887653



>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2btoa1 c.32.1.1 (A:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tubb1 c.32.1.1 (B:1-245) Tubulin beta-subunit {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure