Citrus Sinensis ID: 019119

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340------
MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPSS
ccEEccEEEcccccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHcccccccccEEEEEEcccccccccccccHHHHHHHcccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHcccHHHHHHHHccccccEEEccccccccccccHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHccccccccccccEEccEEEEEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHcccccccc
HHccccEEEcHHHccEEEccccHHHccEEEEEcccccccccEEccHHHHHcccHHHHHHHHHHHHHHHHHHcHHHcccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccccccccHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccHHHHHHHHcccccccccccccccEcHHHHHcccccccEcHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEEccEEEEEEccccccHHHHcHHHHHHHHHHHHHccccccc
meelgpfrvnsdgktlyrneyAWNNVANVLFletpagvgfsysntssdysnpgdnntaedSYTFLVNWFerfpqyknrdffitgesyaghyvpqLAYTILSKNTSKTIINLKGIAignawiddnlctkgMFDFFwthalnsdetNAAINKYCdfatgqlstscdqyqtqgvreygqidlynvyaplckssapppptagvireydpcsdkyVNSYLNLAEVQAALHAkhtnwstcsdltwtdspstvlPTIQQLIASGIRVWiysgdtdgrvpvtssrysinalnlpvetawypwyadgevggyVLGYKGVIFTTvrgaghlvptyqpqRALIMISSFlegklppss
meelgpfrvnsdgktlYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSflegklppss
MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPSS
************GKTLYRNEYAWNNVANVLFLETPAGVGFSY******************SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKS******TAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFL********
MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFL*GKLP***
MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFL********
*EELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKL****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query346 2.2.26 [Sep-21-2011]
P52711516 Serine carboxypeptidase I N/A no 0.988 0.662 0.588 1e-114
Q0WRX3502 Serine carboxypeptidase-l yes no 0.994 0.685 0.554 1e-111
Q9M099465 Serine carboxypeptidase 2 no no 0.997 0.741 0.5 1e-102
Q9ZQQ0452 Serine carboxypeptidase-l no no 0.985 0.754 0.491 1e-96
Q949Q7479 Serine carboxypeptidase-l no no 0.979 0.707 0.481 2e-95
P55748436 Serine carboxypeptidase I N/A no 0.991 0.786 0.490 1e-94
Q0WPR4499 Serine carboxypeptidase-l no no 0.994 0.689 0.458 2e-94
Q1PF08464 Serine carboxypeptidase-l no no 0.971 0.724 0.464 4e-94
Q9SFB5459 Serine carboxypeptidase-l no no 0.991 0.747 0.488 1e-93
P08819444 Serine carboxypeptidase 2 N/A no 0.985 0.768 0.475 6e-93
>sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 Back     alignment and function desciption
 Score =  413 bits (1061), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/360 (58%), Positives = 255/360 (70%), Gaps = 18/360 (5%)

Query: 1   MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAED 60
           MEELGPFRV SDGKTLY N Y+WN+ ANVLFLE+PAGVG+SYSNT++DY   GDN TAED
Sbjct: 151 MEELGPFRVMSDGKTLYSNPYSWNHAANVLFLESPAGVGYSYSNTTADYGRSGDNGTAED 210

Query: 61  SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAW 120
           +Y FL NW ERFP+YK R+F+ITGESYAGHYVPQLA+ IL   +    INLKGI IGNA 
Sbjct: 211 AYQFLDNWLERFPEYKGREFYITGESYAGHYVPQLAHAILRHASPD--INLKGIMIGNAV 268

Query: 121 IDDNLCTKGMFDFFWTHALNSDETNAAINKYCDF---ATGQLSTS-CDQYQTQGVREYGQ 176
           I+D   +KGM+DFFWTHAL SDET   I+K C+F     G  S + CD    +       
Sbjct: 269 INDWTDSKGMYDFFWTHALISDETADGISKNCNFTAYGAGVASNALCDAASDEVGESLAD 328

Query: 177 IDLYNVYAPLCKSSA-PPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTN----W 231
           ID+YN+YAP C+S     PP A  I  +DPC+D YV +YLN  +VQ ALHA  T     W
Sbjct: 329 IDIYNIYAPNCQSEKLVTPPIAPSIDNFDPCTDYYVEAYLNRPDVQKALHANVTRLDHPW 388

Query: 232 STCSDL--TWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVET 289
           S CSD+   W DS  TVLP IQ+L+ + IRVW+YSGDTDGRVPVTSSR S+N L LPV  
Sbjct: 389 SACSDVLTRWVDSAKTVLPIIQELMKNSIRVWVYSGDTDGRVPVTSSRLSVNQLQLPVAA 448

Query: 290 AWYPWYAD----GEVGGYVLGYKGVI-FTTVRGAGHLVPTYQPQRALIMISSFLEGKLPP 344
            W PW++     GEVGGY++ YKG +   TVRGAGH VP+YQP+RAL+++ +FL GK  P
Sbjct: 449 KWRPWFSSTKGAGEVGGYIVQYKGDLSLVTVRGAGHEVPSYQPRRALVLVQNFLAGKALP 508

Hordeum vulgare (taxid: 4513)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: 6
>sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 Back     alignment and function description
>sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 Back     alignment and function description
>sp|Q949Q7|SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1 Back     alignment and function description
>sp|P55748|CBP22_HORVU Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1 Back     alignment and function description
>sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 Back     alignment and function description
>sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 Back     alignment and function description
>sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 Back     alignment and function description
>sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
225458529 488 PREDICTED: serine carboxypeptidase II-3- 1.0 0.709 0.735 1e-152
302142365 1017 unnamed protein product [Vitis vinifera] 1.0 0.340 0.735 1e-151
356552178 495 PREDICTED: serine carboxypeptidase II-3- 0.994 0.694 0.696 1e-145
363814475 496 uncharacterized protein LOC100820473 pre 0.994 0.693 0.681 1e-142
357443925 497 Serine carboxypeptidase-like protein [Me 0.997 0.694 0.658 1e-132
357443929 494 Serine carboxypeptidase-like protein [Me 1.0 0.700 0.658 1e-132
357462111 497 Serine carboxypeptidase-like protein [Me 0.997 0.694 0.655 1e-132
356547861433 PREDICTED: serine carboxypeptidase II-3- 1.0 0.799 0.648 1e-131
357443919 495 Serine carboxypeptidase II-3 [Medicago t 1.0 0.698 0.659 1e-131
357443923 495 Serine carboxypeptidase-like protein [Me 1.0 0.698 0.656 1e-130
>gi|225458529|ref|XP_002282331.1| PREDICTED: serine carboxypeptidase II-3-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  542 bits (1396), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 256/348 (73%), Positives = 290/348 (83%), Gaps = 2/348 (0%)

Query: 1   MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAED 60
           MEELGPFRVN DGKTL+RNEYAWNNV+NV+FLE+PAGVGFSYSNTSSDY N GD  TAED
Sbjct: 141 MEELGPFRVNPDGKTLFRNEYAWNNVSNVIFLESPAGVGFSYSNTSSDYVNVGDKKTAED 200

Query: 61  SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKN--TSKTIINLKGIAIGN 118
           SYTFL+NW ERFPQYK RDFFITGESY+GHYVPQLAYTILS N  T++T+INLKGIAIGN
Sbjct: 201 SYTFLINWLERFPQYKTRDFFITGESYSGHYVPQLAYTILSNNNKTNQTVINLKGIAIGN 260

Query: 119 AWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLSTSCDQYQTQGVREYGQID 178
           AWIDDN   KG++D+ WTHAL+SDE+NA I KYCDF TG  ST C  Y  Q   E G ID
Sbjct: 261 AWIDDNTSLKGIYDYIWTHALSSDESNAGIQKYCDFTTGNFSTKCLDYTYQAEGEVGNID 320

Query: 179 LYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTNWSTCSDLT 238
           +YN+YAPLC SS P   + G + ++DPCSD YV SYLNLAEVQ ALHA++T W  CS + 
Sbjct: 321 IYNIYAPLCHSSGPTSRSVGSVNDFDPCSDYYVESYLNLAEVQKALHARNTTWGACSGVG 380

Query: 239 WTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYADG 298
           WTDSP+T+LPTI+QL+ASGI VWIYSGDTDGRVPVTSSRYSIN   LPV+TAW PWY + 
Sbjct: 381 WTDSPTTILPTIKQLMASGISVWIYSGDTDGRVPVTSSRYSINTFKLPVKTAWRPWYYNK 440

Query: 299 EVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPSS 346
           EVGGYV+ YKGV+F TVRGAGHLVP+YQP RAL MI+SFL+G LPP S
Sbjct: 441 EVGGYVVEYKGVVFATVRGAGHLVPSYQPGRALTMIASFLQGTLPPPS 488

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302142365|emb|CBI19568.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552178|ref|XP_003544446.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max] Back     alignment and taxonomy information
>gi|363814475|ref|NP_001242872.1| uncharacterized protein LOC100820473 precursor [Glycine max] gi|255636975|gb|ACU18820.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357443925|ref|XP_003592240.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481288|gb|AES62491.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357443929|ref|XP_003592242.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462115|ref|XP_003601339.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481290|gb|AES62493.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490387|gb|AES71590.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357462111|ref|XP_003601337.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490385|gb|AES71588.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356547861|ref|XP_003542323.1| PREDICTED: serine carboxypeptidase II-3-like [Glycine max] Back     alignment and taxonomy information
>gi|357443919|ref|XP_003592237.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|357462105|ref|XP_003601334.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355481285|gb|AES62488.1| Serine carboxypeptidase II-3 [Medicago truncatula] gi|355490382|gb|AES71585.1| Serine carboxypeptidase II-3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357443923|ref|XP_003592239.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|357462109|ref|XP_003601336.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355481287|gb|AES62490.1| Serine carboxypeptidase-like protein [Medicago truncatula] gi|355490384|gb|AES71587.1| Serine carboxypeptidase-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query346
TAIR|locus:2087368502 scpl40 "serine carboxypeptidas 0.994 0.685 0.562 9.5e-105
TAIR|locus:2118706465 BRS1 "BRI1 SUPPRESSOR 1" [Arab 0.658 0.490 0.475 2.8e-103
TAIR|locus:2061436464 scpl22 "serine carboxypeptidas 0.650 0.484 0.439 2e-96
TAIR|locus:2039275452 scpl26 "serine carboxypeptidas 0.982 0.752 0.494 3e-92
TAIR|locus:2008480463 SCPL32 "serine carboxypeptidas 0.650 0.485 0.464 3.8e-91
TAIR|locus:2166870499 SCPL34 "serine carboxypeptidas 0.537 0.372 0.521 6.2e-91
TAIR|locus:2077422459 SCPL27 "serine carboxypeptidas 0.991 0.747 0.494 2.2e-89
TAIR|locus:2078598473 scpl25 "serine carboxypeptidas 0.549 0.401 0.5 2.4e-89
TAIR|locus:2181504480 scpl35 "serine carboxypeptidas 0.615 0.443 0.431 1.2e-83
TAIR|locus:2086137478 scpl33 "serine carboxypeptidas 0.546 0.395 0.489 6.5e-83
TAIR|locus:2087368 scpl40 "serine carboxypeptidase-like 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1037 (370.1 bits), Expect = 9.5e-105, P = 9.5e-105
 Identities = 202/359 (56%), Positives = 252/359 (70%)

Query:     1 MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAED 60
             ++ELGPFRV+SDGKTL+RN YAWNN ANVLFLE+PAGVGFSY+NT+SD    GD NTA D
Sbjct:   144 LQELGPFRVHSDGKTLFRNRYAWNNAANVLFLESPAGVGFSYTNTTSDLEKHGDRNTAAD 203

Query:    61 SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAW 120
             +Y FLVNW ERFP+YK RD +I GESYAGHYVPQLA+TIL  + S    NLKGI IGNA 
Sbjct:   204 NYIFLVNWLERFPEYKGRDLYIAGESYAGHYVPQLAHTILLHHRS--FFNLKGILIGNAV 261

Query:   121 IDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATGQLST---SCDQYQTQGVREYGQI 177
             I+D     GM+DFF +HAL S+++ A +   CD  T   S     C     Q   +   +
Sbjct:   262 INDETDLMGMYDFFESHALISEDSLARLKSNCDLKTESASVMTEECAVVSDQIDMDTYYL 321

Query:   178 DLYNVYAPLC-KSSAPPPPTAGV-IREYDPCSDKYVNSYLNLAEVQAALHAKHTN----W 231
             D+YN+YAPLC  S+    P  G  IRE+DPCSD YV +YLN  EVQAALHA  T     W
Sbjct:   322 DIYNIYAPLCLNSTLTRRPKRGTTIREFDPCSDHYVQAYLNRPEVQAALHANATKLPYEW 381

Query:   232 STCSDLT--WTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINALNLPVET 289
               CS +   W DSP+TV+P I++L+  G+RVW++SGDTDGR+PVTS++YS+  +NL  +T
Sbjct:   382 QPCSSVIKKWNDSPTTVIPLIKELMGQGVRVWVFSGDTDGRIPVTSTKYSLKKMNLTAKT 441

Query:   290 AWYPWYADGEVGGYVLGYKGVI-FTTVRGAGHLVPTYQPQRALIMISSFL-EGKLPPSS 346
             AW+PWY  GEVGGY   YKG + F TVRGAGH VP++QP+R+L +   FL +  LP +S
Sbjct:   442 AWHPWYLGGEVGGYTEEYKGKLTFATVRGAGHQVPSFQPKRSLSLFIHFLNDTPLPDTS 500
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2118706 BRS1 "BRI1 SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061436 scpl22 "serine carboxypeptidase-like 22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039275 scpl26 "serine carboxypeptidase-like 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2008480 SCPL32 "serine carboxypeptidase-like 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166870 SCPL34 "serine carboxypeptidase-like 34" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2077422 SCPL27 "serine carboxypeptidase-like 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078598 scpl25 "serine carboxypeptidase-like 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181504 scpl35 "serine carboxypeptidase-like 35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086137 scpl33 "serine carboxypeptidase-like 33" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WRX3SCP40_ARATH3, ., 4, ., 1, 6, ., -0.55430.99420.6852yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.160.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014760001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (988 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 1e-144
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 2e-39
COG2939498 COG2939, COG2939, Carboxypeptidase C (cathepsin A) 5e-39
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 6e-33
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 2e-29
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 2e-24
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  414 bits (1067), Expect = e-144
 Identities = 157/359 (43%), Positives = 199/359 (55%), Gaps = 21/359 (5%)

Query: 1   MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAED 60
            EELGPFRVNS G TLY N Y+WN VANVLFL+ P GVGFSYSNT+SDY    D  TA+D
Sbjct: 59  FEELGPFRVNS-GPTLYLNPYSWNKVANVLFLDQPVGVGFSYSNTTSDY-KTDDEETAKD 116

Query: 61  SYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKN--TSKTIINLKGIAIGN 118
           +Y FL  +FE+FP+YKN  F+I GESYAGHYVP LA  IL  N   +   INLKG+ IGN
Sbjct: 117 NYEFLQKFFEKFPEYKNNPFYIAGESYAGHYVPALAQEILDGNKKGTGPNINLKGVLIGN 176

Query: 119 AWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATG---QLSTSCDQYQTQGVRE-- 173
              D  +       F + H L SDE   ++ K C          +T C     +      
Sbjct: 177 GLTDPAIQYNSYIPFAYYHGLISDELYESLKKACCGKYPDCDPANTKCLNLVEEASGCNA 236

Query: 174 -YGQIDLYNVYAPLCKSSAPP--PPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHT- 229
             G I+ YN+Y P C +S+    P +      YD   + YV  YLN  +V+ ALHA    
Sbjct: 237 YNGGINPYNIYTPCCYNSSLSLNPSSTDSCGGYDCYDESYVEKYLNRPDVRKALHANKGS 296

Query: 230 --NWSTCSD----LTWTDSPSTVLPTIQQLIASGIRVWIYSGDTDGRVPVTSSRYSINAL 283
              WS C+D        D   ++LP + +L+  G+RV IYSGD D       ++  I+AL
Sbjct: 297 VGEWSRCNDEVFNWYGDDISKSMLPILPKLLEGGLRVLIYSGDHDLICNFLGTQAWIDAL 356

Query: 284 NLPVETAWYPWY--ADGEVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEG 340
           N   +  + PWY   DG+V GYV  Y  + F TV+GAGH+VP  QP+ AL M   FL G
Sbjct: 357 NWSGKDGFRPWYVSVDGQVAGYVKSYGNLTFATVKGAGHMVPEDQPEAALQMFKRFLSG 415

Length = 415
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>gnl|CDD|225490 COG2939, COG2939, Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 346
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02209437 serine carboxypeptidase 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 100.0
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 100.0
PRK03204286 haloalkane dehalogenase; Provisional 98.89
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.85
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.84
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.83
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.82
PLN02824294 hydrolase, alpha/beta fold family protein 98.76
PHA02857276 monoglyceride lipase; Provisional 98.74
PRK10349256 carboxylesterase BioH; Provisional 98.73
PLN02385349 hydrolase; alpha/beta fold family protein 98.68
PRK00870302 haloalkane dehalogenase; Provisional 98.67
PRK10673255 acyl-CoA esterase; Provisional 98.64
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.63
PLN02679360 hydrolase, alpha/beta fold family protein 98.62
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.59
PRK03592295 haloalkane dehalogenase; Provisional 98.57
PLN02578354 hydrolase 98.56
PLN02298330 hydrolase, alpha/beta fold family protein 98.56
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.55
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.49
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.39
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 98.34
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 98.33
PRK10749330 lysophospholipase L2; Provisional 98.28
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.27
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.25
PLN02965255 Probable pheophorbidase 98.25
PLN02894402 hydrolase, alpha/beta fold family protein 98.17
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.17
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 98.16
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 98.07
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.06
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 98.06
PLN02652395 hydrolase; alpha/beta fold family protein 98.04
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 97.94
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 97.86
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.79
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 97.62
PLN02511388 hydrolase 97.5
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.43
KOG1455313 consensus Lysophospholipase [Lipid transport and m 97.43
PRK06765389 homoserine O-acetyltransferase; Provisional 97.42
PLN02872395 triacylglycerol lipase 97.2
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.18
PRK07581339 hypothetical protein; Validated 96.83
PRK08775343 homoserine O-acetyltransferase; Provisional 96.71
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.52
KOG2382315 consensus Predicted alpha/beta hydrolase [General 96.51
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 96.46
PRK10985324 putative hydrolase; Provisional 96.38
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 96.38
PRK00175379 metX homoserine O-acetyltransferase; Provisional 96.01
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 95.84
PRK06489360 hypothetical protein; Provisional 95.7
PRK05077414 frsA fermentation/respiration switch protein; Revi 95.59
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 95.52
PLN02211273 methyl indole-3-acetate methyltransferase 95.42
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 95.04
PRK08775343 homoserine O-acetyltransferase; Provisional 94.65
PRK06489360 hypothetical protein; Provisional 94.38
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 94.08
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 93.17
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 93.03
PRK05855 582 short chain dehydrogenase; Validated 92.72
PRK11460232 putative hydrolase; Provisional 92.61
PLN02454414 triacylglycerol lipase 92.18
PRK10566249 esterase; Provisional 92.1
PLN02211273 methyl indole-3-acetate methyltransferase 92.03
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 91.98
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 91.87
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 91.4
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 91.06
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 90.31
PRK10566249 esterase; Provisional 90.29
PRK05855 582 short chain dehydrogenase; Validated 90.12
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 90.12
PLN02442283 S-formylglutathione hydrolase 90.07
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 89.63
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 89.08
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 89.01
KOG2564343 consensus Predicted acetyltransferases and hydrola 88.78
PF05577434 Peptidase_S28: Serine carboxypeptidase S28; InterP 88.76
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 88.51
PRK07581339 hypothetical protein; Validated 88.29
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 88.27
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 86.15
COG0400207 Predicted esterase [General function prediction on 86.12
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 86.09
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 86.02
PLN02571413 triacylglycerol lipase 85.97
PRK00175379 metX homoserine O-acetyltransferase; Provisional 85.84
PLN00021313 chlorophyllase 85.49
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 85.25
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 85.16
PRK10162318 acetyl esterase; Provisional 85.08
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 84.85
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 83.94
PRK13604307 luxD acyl transferase; Provisional 82.8
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 82.64
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 82.21
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 82.08
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 82.06
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 81.76
KOG1552258 consensus Predicted alpha/beta hydrolase [General 81.39
PLN02753531 triacylglycerol lipase 80.45
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-97  Score=704.78  Aligned_cols=345  Identities=49%  Similarity=0.874  Sum_probs=312.6

Q ss_pred             CceecCeEEeCCCCceeeCCCCcccccceEEEECCCCcccccccCCCCCCCCCcHHHHHHHHHHHHHHHHHCCCCCCCce
Q 019119            1 MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDF   80 (346)
Q Consensus         1 f~E~GP~~~~~~~~~~~~n~~sW~~~an~lyiDqPvG~GfS~~~~~~~~~~~~~~~~a~~~~~fL~~f~~~fp~~~~~~~   80 (346)
                      |.|+|||+++.||.+|..||||||+.||||||||||||||||+++..++. .+|+.+|+|++.||++||++||||++|+|
T Consensus        92 ~~E~GPf~v~~~G~tL~~N~ySWnk~aNiLfLd~PvGvGFSYs~~~~~~~-~~D~~~A~d~~~FL~~wf~kfPey~~~~f  170 (454)
T KOG1282|consen   92 FEENGPFRVKYNGKTLYLNPYSWNKEANILFLDQPVGVGFSYSNTSSDYK-TGDDGTAKDNYEFLQKWFEKFPEYKSNDF  170 (454)
T ss_pred             hhhcCCeEEcCCCCcceeCCccccccccEEEEecCCcCCccccCCCCcCc-CCcHHHHHHHHHHHHHHHHhChhhcCCCe
Confidence            68999999999999999999999999999999999999999999988887 48999999999999999999999999999


Q ss_pred             EEEcccccceehHHHHHHHHHhCC--CCceeeeeEEEEeCCCCCccccccchhHHHhhcCCCCHHHHHHHHhhccccC--
Q 019119           81 FITGESYAGHYVPQLAYTILSKNT--SKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFAT--  156 (346)
Q Consensus        81 ~i~GESYgG~yvP~la~~i~~~n~--~~~~inLkGi~iGNg~~dp~~q~~~~~~~~~~~gli~~~~~~~~~~~c~~~~--  156 (346)
                      ||+||||||||||+||++|+++|.  ..+.|||||++||||++|+..|..++.+|++.||+|+++.++.+.+.|....  
T Consensus       171 yI~GESYAG~YVP~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~  250 (454)
T KOG1282|consen  171 YIAGESYAGHYVPALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDN  250 (454)
T ss_pred             EEecccccceehHHHHHHHHhccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCccc
Confidence            999999999999999999999982  4678999999999999999999999999999999999999999999998732  


Q ss_pred             ----CCChhhHHHHHHHHH-HhcCCCCcccccccccCCCCCCCCCCCCccCCCCCCchHHHhhcChHHHHHhhccCCCC-
Q 019119          157 ----GQLSTSCDQYQTQGV-REYGQIDLYNVYAPLCKSSAPPPPTAGVIREYDPCSDKYVNSYLNLAEVQAALHAKHTN-  230 (346)
Q Consensus       157 ----~~~~~~c~~~~~~~~-~~~~~~n~y~i~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~ylN~~~V~~aL~v~~~~-  230 (346)
                          ...+..|..+++... ...+.++.|+++.+.|...............+++|...+.+.|||+++||+||||+... 
T Consensus       251 ~~~~~~~~~~C~~~~~~~~~~~~~~i~~y~i~~~~C~~~~~~~~~~~~~~~~~~c~~~~~~~ylN~~~VrkALh~~~~~~  330 (454)
T KOG1282|consen  251 YANVDPSNTKCNKAVEEFDSKTTGDIDNYYILTPDCYPTSYELKKPTDCYGYDPCLSDYAEKYLNRPEVRKALHANKTSI  330 (454)
T ss_pred             ccccCCchhHHHHHHHHHHHHHhccCchhhhcchhhccccccccccccccccCCchhhhHHHhcCCHHHHHHhCCCCCCC
Confidence                133668999998887 66678999999999998622111000112456889887778999999999999998764 


Q ss_pred             --cccccccc---cccCCCChHHHHHHHHHcC-CeEEEEecCCCccCCcccHHHHHHhcCCCCcccccccccC-CeEeEE
Q 019119          231 --WSTCSDLT---WTDSPSTVLPTIQQLIASG-IRVWIYSGDTDGRVPVTSSRYSINALNLPVETAWYPWYAD-GEVGGY  303 (346)
Q Consensus       231 --w~~c~~~v---~~d~~~~~~~~l~~LL~~~-irVLiy~Gd~D~i~n~~g~~~~i~~l~w~~~~~~~~~~~~-~~~~G~  303 (346)
                        |+.||..|   |.+...+++|.+..++.++ +|||||+||.|++||+.||++||++|+++...+|+||+++ +|+|||
T Consensus       331 ~~W~~Cn~~v~~~~~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~~i~~L~~~~~~~~~pW~~~~~qvaG~  410 (454)
T KOG1282|consen  331 GKWERCNDEVNYNYNDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQAWIKSLNLSITDEWRPWYHKGGQVAGY  410 (454)
T ss_pred             CcccccChhhhcccccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhHHHHHhccCccccCccCCccCCCceeee
Confidence              99999998   6788999999999999865 9999999999999999999999999999999999999995 899999


Q ss_pred             EEEEcCEEEEEEcCCcccCCCCChHHHHHHHHHHHcCCCCCCC
Q 019119          304 VLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLPPSS  346 (346)
Q Consensus       304 ~k~~~nLtf~~V~~AGHmvP~dqP~~a~~m~~~fl~~~~~~~~  346 (346)
                      +++|+||||+||+|||||||.|||++|+.||++||.|+++++.
T Consensus       411 ~~~Y~~ltf~tVrGaGH~VP~~~p~~al~m~~~fl~g~~l~~~  453 (454)
T KOG1282|consen  411 TKTYGGLTFATVRGAGHMVPYDKPESALIMFQRFLNGQPLPST  453 (454)
T ss_pred             EEEecCEEEEEEeCCcccCCCCCcHHHHHHHHHHHcCCCCCCC
Confidence            9999999999999999999999999999999999999999863

>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
1bcr_A263 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 6e-50
1whs_A255 Structure Of The Complex Of L-Benzylsuccinate With 7e-50
1wht_A256 Structure Of The Complex Of L-Benzylsuccinate With 8e-50
3sc2_A259 Refined Atomic Model Of Wheat Serine Carboxypeptida 8e-50
1gxs_A270 Crystal Structure Of Hydroxynitrile Lyase From Sorg 1e-43
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 4e-41
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 5e-41
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 5e-41
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 5e-41
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 3e-38
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 4e-35
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 2e-26
1wpx_A421 Crystal Structure Of Carboxypeptidase Y Inhibitor C 4e-22
1ac5_A483 Crystal Structure Of Kex1(delta)p, A Prohormone-pro 4e-22
1cpy_A421 Site-Directed Mutagenesis On (Serine) Carboxypeptid 9e-21
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 5e-10
>pdb|1BCR|A Chain A, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 263 Back     alignment and structure 
Iteration: 1

 Score =  194 bits (493), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 119/187 (63%), Gaps = 3/187 (1%)
Query: 2   EELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDS 61
           EELG FRV   G  L  NEY WN VANVLFL++PAGVGFSY+NTSSD    GDN TA DS
Sbjct: 74  EELGAFRVKPRGAGLVLNEYRWNKVANVLFLDSPAGVGFSYTNTSSDIYTSGDNRTAHDS 133
Query: 62  YTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWI 121
           Y FL  WFERFP YK RDF+I GESYAGHYVP+L  + L   +   +INLKG  +GN  I
Sbjct: 134 YAFLAKWFERFPHYKYRDFYIAGESYAGHYVPEL--SQLVHRSKNPVINLKGFMVGNGLI 191
Query: 122 DDNLCTKGMFDFFWTHALNSDETNAAINKYCDFATG-QLSTSCDQYQTQGVREYGQIDLY 180
           DD     G F+F+W H + SD+T   + + C   +    S +CD        E G ID+Y
Sbjct: 192 DDYHDYVGTFEFWWNHGIVSDDTYRRLKEACLHDSFIHPSPACDAATDVATAEQGNIDMY 251
Query: 181 NVYAPLC 187
           ++Y P+C
Sbjct: 252 SLYTPVC 258
>pdb|1WHS|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 255 Back     alignment and structure
>pdb|1WHT|A Chain A, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 256 Back     alignment and structure
>pdb|3SC2|A Chain A, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|1GXS|A Chain A, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 270 Back     alignment and structure
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure
>pdb|1WPX|A Chain A, Crystal Structure Of Carboxypeptidase Y Inhibitor Complexed With The Cognate Proteinase Length = 421 Back     alignment and structure
>pdb|1AC5|A Chain A, Crystal Structure Of Kex1(delta)p, A Prohormone-processing Carboxypeptidase From Saccharomyces Cerevisiae Length = 483 Back     alignment and structure
>pdb|1CPY|A Chain A, Site-Directed Mutagenesis On (Serine) Carboxypeptidase Y From Yeast. The Significance Of Thr 60 And Met 398 In Hydrolysis And Aminolysis Reactions Length = 421 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query346
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 1e-141
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 1e-139
1ivy_A452 Human protective protein; carboxypeptidase, serine 1e-138
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 7e-90
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 1e-86
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 7e-65
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 5e-63
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
 Score =  407 bits (1047), Expect = e-141
 Identities = 84/390 (21%), Positives = 146/390 (37%), Gaps = 47/390 (12%)

Query: 1   MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDN----- 55
           + E GPFRVNSDGK LY NE +W +  ++LF++ P G GFS      +     +      
Sbjct: 86  LVESGPFRVNSDGK-LYLNEGSWISKGDLLFIDQPTGTGFSVEQNKDEGKIDKNKFDEDL 144

Query: 56  -NTAEDSYTFLVNWFERFPQYKNRDFFITGESYAGHYVPQLAYTILSKN----TSKTIIN 110
            +  +    FL N+F+ FP+   R   ++GESYAG Y+P  A  IL+ N          +
Sbjct: 145 EDVTKHFMDFLENYFKIFPEDLTRKIILSGESYAGQYIPFFANAILNHNKFSKIDGDTYD 204

Query: 111 LKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDE--TNAAINKYCDFATGQLSTSCDQYQT 168
           LK + IGN WID N  +     F     L  +       +    +     ++ S    + 
Sbjct: 205 LKALLIGNGWIDPNTQSLSYLPFAMEKKLIDESNPNFKHLTNAHENCQNLIN-SASTDEA 263

Query: 169 QGVREYGQIDLYNVYAPLCKSSAPPPPTAGV-------------IREYDPCSDKYVNSYL 215
                    ++ N+     + S+       +                  P    +V+ + 
Sbjct: 264 AHFSYQECENILNLLLSYTRESSQKGTADCLNMYNFNLKDSYPSCGMNWPKDISFVSKFF 323

Query: 216 NLAEVQAALHA---KHTNWSTCSDL----TWTDSPSTVLPTIQQLIASGIRVWIYSGDTD 268
           +   V  +LH    K  +W  C++              +  +  L+ SGI + +++GD D
Sbjct: 324 STPGVIDSLHLDSDKIDHWKECTNSVGTKLSNPISKPSIHLLPGLLESGIEIVLFNGDKD 383

Query: 269 GRVPVTSSRYSINALNLP------VETAWYPWYA-------DGEVGGYVLGYKGVIFTTV 315
                     +I+ L          +   + W           E  GYV   + + F +V
Sbjct: 384 LICNNKGVLDTIDNLKWGGIKGFSDDAVSFDWIHKSKSTDDSEEFSGYVKYDRNLTFVSV 443

Query: 316 RGAGHLVPTYQPQRALIMISSFLEGKLPPS 345
             A H+VP  +   +  ++  +    +   
Sbjct: 444 YNASHMVPFDKSLVSRGIVDIYSNDVMIID 473
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 100.0
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.02
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.99
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.96
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.86
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.86
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.84
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.82
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.8
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.79
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.78
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.76
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.76
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.75
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 98.74
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.74
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.73
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 98.72
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.7
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.7
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.69
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.69
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.67
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.67
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.67
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.67
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.66
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 98.65
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.64
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.63
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.62
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.62
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.62
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.62
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.61
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.6
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.6
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.6
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.6
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.59
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 98.58
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.57
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.57
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.57
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.56
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.55
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 98.55
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.54
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.5
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.49
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.47
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 98.47
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.46
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.45
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.44
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.43
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.4
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.4
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.4
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.38
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.37
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.36
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.35
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.35
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.34
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.33
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.33
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.31
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.31
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.3
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.28
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.27
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.23
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.23
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.23
3h04_A275 Uncharacterized protein; protein with unknown func 98.22
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.21
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.19
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.19
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.16
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.14
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.14
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.11
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.36
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 98.06
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.06
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.03
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.01
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 97.92
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.88
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 97.86
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 97.85
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 97.84
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.81
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 97.8
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.71
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 97.7
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.69
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 97.67
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.66
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 97.62
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 97.51
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 97.49
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.46
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 97.46
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.44
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.39
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.37
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.32
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 97.31
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 97.31
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 97.28
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 97.21
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 97.2
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.12
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 97.08
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.07
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 97.03
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.02
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.99
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.96
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.93
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.93
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 96.91
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.89
3ain_A323 303AA long hypothetical esterase; carboxylesterase 96.77
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 96.74
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.72
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 96.71
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 96.63
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 96.58
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.57
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 96.51
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.5
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.39
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.38
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.29
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 96.27
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 96.26
1r3d_A264 Conserved hypothetical protein VC1974; structural 96.24
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 96.13
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.05
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 95.78
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 95.78
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 95.69
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 95.65
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.62
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 95.57
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 95.53
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 95.48
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 95.44
1vkh_A273 Putative serine hydrolase; structural genomics, jo 95.06
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 94.95
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 94.82
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 94.74
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 94.74
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 94.74
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 94.69
1r3d_A264 Conserved hypothetical protein VC1974; structural 94.68
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 94.62
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 94.47
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 94.44
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 94.18
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 94.05
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 94.03
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 93.98
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 93.79
4f21_A246 Carboxylesterase/phospholipase family protein; str 93.74
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 93.73
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.62
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 93.36
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 92.81
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 92.81
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 92.81
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 92.71
4fle_A202 Esterase; structural genomics, PSI-biology, northe 92.63
3bjr_A283 Putative carboxylesterase; structural genomics, jo 92.62
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 92.59
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 92.52
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 92.33
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 92.27
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 92.26
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 92.02
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 92.01
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 91.9
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 91.85
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 91.75
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 91.61
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 91.6
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 91.54
3tej_A329 Enterobactin synthase component F; nonribosomal pe 91.51
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 91.48
1kez_A300 Erythronolide synthase; polyketide synthase, modul 91.37
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 91.31
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 91.1
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 90.96
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 90.76
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 90.7
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 90.6
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 90.44
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 90.36
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 90.25
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 90.24
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 90.14
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 89.98
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 89.89
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 89.88
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 89.82
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 89.72
1kez_A300 Erythronolide synthase; polyketide synthase, modul 89.58
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 89.57
3bjr_A283 Putative carboxylesterase; structural genomics, jo 89.52
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 89.32
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 88.77
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 88.74
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 88.58
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 88.39
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 88.39
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 88.22
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 87.94
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 87.89
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 87.84
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 87.62
4ebb_A472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 87.19
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 86.96
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 86.95
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 86.91
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 86.67
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 86.59
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 86.19
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 86.06
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 85.85
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 85.84
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 85.82
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 85.76
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 85.69
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 85.61
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 85.53
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 85.49
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 85.23
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 85.19
1vkh_A273 Putative serine hydrolase; structural genomics, jo 85.01
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 84.96
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 84.75
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 84.31
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 83.62
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 83.55
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 83.47
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 83.23
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 82.67
3lp5_A250 Putative cell surface hydrolase; structural genom 82.03
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 81.98
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 81.74
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 81.46
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 80.48
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 80.11
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 80.09
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=1.9e-87  Score=647.64  Aligned_cols=336  Identities=32%  Similarity=0.609  Sum_probs=292.7

Q ss_pred             CceecCeEEeCCCCceeeCCCCcccccceEEEECCCCcccccccCCCCCCCCCcHHHHHHHHHHHHHHHHHCCCCCCCce
Q 019119            1 MEELGPFRVNSDGKTLYRNEYAWNNVANVLFLETPAGVGFSYSNTSSDYSNPGDNNTAEDSYTFLVNWFERFPQYKNRDF   80 (346)
Q Consensus         1 f~E~GP~~~~~~~~~~~~n~~sW~~~an~lyiDqPvG~GfS~~~~~~~~~~~~~~~~a~~~~~fL~~f~~~fp~~~~~~~   80 (346)
                      |.|+|||+++.++.+++.||+||++.|||||||||+||||||.++ .++. .+++++|+++++||++||++||+|++++|
T Consensus        67 ~~e~GP~~~~~~~~~l~~n~~sw~~~~~~lfiDqP~GtGfS~~~~-~~~~-~~~~~~a~~~~~~l~~f~~~~p~~~~~~~  144 (452)
T 1ivy_A           67 LTEHGPFLVQPDGVTLEYNPYSWNLIANVLYLESPAGVGFSYSDD-KFYA-TNDTEVAQSNFEALQDFFRLFPEYKNNKL  144 (452)
T ss_dssp             HTTTSSEEECTTSSCEEECTTCGGGSSEEEEECCSTTSTTCEESS-CCCC-CBHHHHHHHHHHHHHHHHHHSGGGTTSCE
T ss_pred             HHhcCCcEEeCCCceeeeCCCcccccccEEEEecCCCCCcCCcCC-CCCc-CCcHHHHHHHHHHHHHHHHhcHHhcCCCE
Confidence            579999999998888999999999999999999999999999654 3555 37889999999999999999999999999


Q ss_pred             EEEcccccceehHHHHHHHHHhCCCCceeeeeEEEEeCCCCCccccccchhHHHhhcCCCCHHHHHHHHhhcccc-----
Q 019119           81 FITGESYAGHYVPQLAYTILSKNTSKTIINLKGIAIGNAWIDDNLCTKGMFDFFWTHALNSDETNAAINKYCDFA-----  155 (346)
Q Consensus        81 ~i~GESYgG~yvP~la~~i~~~n~~~~~inLkGi~iGNg~~dp~~q~~~~~~~~~~~gli~~~~~~~~~~~c~~~-----  155 (346)
                      ||+||||||+|||+||.+|+++.    +||||||+||||++||..|..++.+|++.||+|++++++.+.+.|...     
T Consensus       145 ~i~GeSYgG~y~p~la~~i~~~~----~~~l~g~~ign~~~d~~~~~~~~~~~~~~~glis~~~~~~~~~~c~~~~~~~~  220 (452)
T 1ivy_A          145 FLTGESYAGIYIPTLAVLVMQDP----SMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNF  220 (452)
T ss_dssp             EEEEETTHHHHHHHHHHHHTTCT----TSCEEEEEEESCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHEETTEECC
T ss_pred             EEEeeccceeehHHHHHHHHhcC----ccccceEEecCCccChhhhhhhHHHHHhhhhcCCHHHHHHHHHHhhhcccccc
Confidence            99999999999999999998643    799999999999999999999999999999999999999999988631     


Q ss_pred             CCCChhhHHHHHHHHHHh--cCCCCcccccccccCCCCCCC---------------CCCC------C---------ccCC
Q 019119          156 TGQLSTSCDQYQTQGVRE--YGQIDLYNVYAPLCKSSAPPP---------------PTAG------V---------IREY  203 (346)
Q Consensus       156 ~~~~~~~c~~~~~~~~~~--~~~~n~y~i~~~~c~~~~~~~---------------~~~~------~---------~~~~  203 (346)
                      .......|..+++.+.+.  .+++|+|||+. .|.......               ..+.      .         ...+
T Consensus       221 ~~~~~~~C~~~~~~~~~~~~~~~in~Y~i~~-~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  299 (452)
T 1ivy_A          221 YDNKDLECVTNLQEVARIVGNSGLNIYNLYA-PCAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRM  299 (452)
T ss_dssp             SSCCCHHHHHHHHHHHHHHHSSSCCTTCTTS-CCTTCCSSSEEEETTEEEECCCSCSSTTSCCCCCCGGGHHHHTCEEEE
T ss_pred             cccchHHHHHHHHHHHHHHhcCCCccccccc-ccccccccccchhcccccccccchhhhhhhhccccccccccccccccC
Confidence            113345799988887765  48899999976 475321100               0000      0         0112


Q ss_pred             -CCCCc-hHHHhhcChHHHHHhhccCCC--Ccccccccc---cccCCCChHHHHHHHHHc-CCeEEEEecCCCccCCccc
Q 019119          204 -DPCSD-KYVNSYLNLAEVQAALHAKHT--NWSTCSDLT---WTDSPSTVLPTIQQLIAS-GIRVWIYSGDTDGRVPVTS  275 (346)
Q Consensus       204 -~~~~~-~~~~~ylN~~~V~~aL~v~~~--~w~~c~~~v---~~d~~~~~~~~l~~LL~~-~irVLiy~Gd~D~i~n~~g  275 (346)
                       .||.. ..+..|||+++||+||||+.+  .|+.||..|   |.+.+.++++.++.||++ |+|||||+||+|++||+.|
T Consensus       300 ~~pc~~~~~~~~ylN~~~Vq~ALhv~~~~~~W~~Cs~~V~~~~~~~~~s~~~~~~~LL~~~girVlIYsGD~D~icn~~G  379 (452)
T 1ivy_A          300 DPPCTNTTAASTYLNNPYVRKALNIPEQLPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMG  379 (452)
T ss_dssp             CCTTCCCHHHHHHHTSHHHHHHTTCCTTSCCCCSBCHHHHHHCBCCCSBSHHHHHHHHHHTCCEEEEEEETTCSSSCHHH
T ss_pred             CCCccchHHHHHHhCcHHHHHHcCCCCCCCccccCcHHHHhhhhcccccHHHHHHHHHhccCceEEEEeCCCCccCCcHH
Confidence             37854 578999999999999999843  399999988   678888999999999998 9999999999999999999


Q ss_pred             HHHHHHhcCCCCcccccccccC-C----eEeEEEEEEcCEEEEEEcCCcccCCCCChHHHHHHHHHHHcCCCC
Q 019119          276 SRYSINALNLPVETAWYPWYAD-G----EVGGYVLGYKGVIFTTVRGAGHLVPTYQPQRALIMISSFLEGKLP  343 (346)
Q Consensus       276 ~~~~i~~l~w~~~~~~~~~~~~-~----~~~G~~k~~~nLtf~~V~~AGHmvP~dqP~~a~~m~~~fl~~~~~  343 (346)
                      |++|+++|+|++..+|+||+++ +    ++|||+|+|+||||++|++||||||+|||++|++||++||.|++|
T Consensus       380 t~~wi~~L~~~~~~~~~pw~~~~~~~~~~vaG~~~~y~nLtf~tV~gAGHmVP~dqP~~al~m~~~fl~g~~l  452 (452)
T 1ivy_A          380 DEWFVDSLNQKMEVQRRPWLVKYGDSGEQIAGFVKEFSHIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY  452 (452)
T ss_dssp             HHHHHHHTCCCEEEEEEEEEEECTTSCEEEEEEEEEESSEEEEEETTCCSSHHHHCHHHHHHHHHHHHTTCCC
T ss_pred             HHHHHHhcCCcccccceeeeeccCCCCcccceEEEEEcceEEEEECCCcccCcccChHHHHHHHHHHhcCCCC
Confidence            9999999999999999999876 5    999999999999999999999999999999999999999999876
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 346
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 2e-98
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 1e-96
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 3e-87
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 5e-82
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 4e-80
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query346
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.04
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.01
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.0
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.97
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.96
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.91
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.88
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.87
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.87
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.87
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.83
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.73
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.73
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.68
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.57
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.56
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.55
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.52
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.47
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.42
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.4
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 97.99
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 97.99
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 97.89
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 97.89
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 97.88
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.45
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.32
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.15
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 96.94
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.82
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.52
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 96.11
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 95.92
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 95.87
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.76
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 95.23
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 93.8
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 93.71
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 93.49
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 92.71
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 92.45
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 92.33
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 91.98
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 91.63
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 91.13
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 90.98
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 90.52
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 90.13
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 90.11
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 89.76
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 89.39
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 89.08
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 88.98
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 87.96
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 87.9
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 87.7
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 87.39
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 87.34
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 87.11
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 86.91
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 86.74
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 86.57
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 85.81
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 85.4
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 85.26
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 84.89
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 84.56
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 84.53
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 84.51
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 84.45
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 84.44
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 84.17
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 83.78
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 82.62
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 82.43
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 80.67
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 80.46
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure