Citrus Sinensis ID: 019145

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MRANFGKIHKSGKNKSPNFTQKFSTTQSSPEKSEDEVKRKMAPVLQSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGVIPPEVVEGLFAVCRSGDFDLANKEVNNIIAEGYPASLLLSQVTLLLFVLMVQHSRQCLYIIYSLLI
cccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHcccccccccEEEECccccccHHHHHHHHHHHHHHccccccccccccccccEEEEEEccccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHccccEECccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcc
*************************************************PWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGVIPPEVVEGLFAVCRSGDFDLANKEVNNIIAEGYPASLLLSQVTLLLFVLMVQHSRQCLYIIYSLLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRANFGKIHKSGKNKSPNFTQKFSTTQSSPEKSEDEVKRKMAPVLQSSQPWVEKYRPKQVKDVAHQEEVVRVLTNTLETANCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKSRVLELNASDDRGINVVRTKIKTFAAVAVGSGQRRGGYPCPPYKIIILDEADSMTEDAQNALRRTMETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSSRVLHICNEEGLNLDAEALSTLSSISQGDLRRAITYLQGAARLFGSSITSKDLISVSGVIPPEVVEGLFAVCRSGDFDLANKEVNNIIAEGYPASLLLSQVTLLLFVLMVQHSRQCLYIIYSLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable replication factor C subunit 4 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.probableQ54MD4
Replication factor C subunit 2 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. Subunit 2 binds ATP and single-stranded DNA.probableQ09843
Replication factor C subunit 4 The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit may be involved in the elongation of the multiprimed DNA template.probableQ99J62

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1SXJ, chain D
Confidence level:very confident
Coverage over the Query: 50-327
View the alignment between query and template
View the model in PyMOL