Citrus Sinensis ID: 019158

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----

MSLLNPKISSPFPFPHSLHSPPQSKFHKLFPSQPLNLPTAATTKLYSLSPLQQEPDYLLLQNEDRVIGDCLVFEEGVFEDPYLENDNVPPPRKPRRSRGKQNVVQVEAENLVPDKWKQVQEELNLTKKEKRQIALQIEFGSRVEKKKQGYLPLNSLDLKEYLAYKEAKLSQLNPPLVLDKPSTFPTDAKESEEDRDCGFQDFVNSSSSTCTQRVPPKNPKWAVYGRGLDDVSEFFNSGNYDPPDKKSDGPRRKLFTKEEKVLLNKKLPHLATATSKKWLPLHSLAASGEFYFVDALLKHNVDINAVDKDGLTALHKAIIGKKQAVTNYLLRESANPFVVDEVMWK

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccCEcccEEEEccccccccccccccccccccccccccccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHccccccccHHHccccccccccccccccccHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccc

*******ISS********************************T*****************QNEDRVIGDCLVFEEGVFEDPYL****************************V*DKWKQVQE*LNL*****RQIALQIEFGSRVEKKKQGYLPLNSLDLKEYLAYKEAKLSQLNPPLVLDKPSTF************CGFQDFVN********RVPPKNPKWAVYGRGLDDVSEFFNSGNYDPPDKKSDGPRRKLFTKEEKVLLNKKLPHLATATSKKWLPLHSLAASGEFYFVDALLKHNVDINAVDKDGLTALHKAIIGKKQAVTNYLLRESANPFVVDEVMWK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ankyrin repeat domain-containing protein, chloroplastic	Involved in the initial differentiation of the proplastid during the embryo development and in plastid differentiation linked to cell differentiation, morphogenesis and organogenesis during the plant life cycle.	probable	Q05753

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 210-345
View the alignment between query and template
View the model in PyMOL

Template: 3UTM, chain A
Confidence level:very confident
Coverage over the Query: 157-345
View the alignment between query and template
View the model in PyMOL

Template: 3LJN, chain A
Confidence level:very confident
Coverage over the Query: 117-339
View the alignment between query and template
View the model in PyMOL