Citrus Sinensis ID: 019163


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MNPSKTTGKQPMAVDIDDMPETPQHRGIHHRRAHSDTSFRFDDFLLFDPSDLDLSALDLPSPNPTPPRGVPMPLDSSEDSSSNSHGQKQQKQSQNPPKPKPINHLRSLSVDSDFFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHSNSMDGFEVESILGDGVKKAVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTNNQTHGQSRPNFMDFNQRV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHccccccccccHHHHHHcccccccccccccccccccccccccccc
************************************TSFRFDDFLLFDPS**************************************************************************************************************L*DGVKKAVDRDRLAELALI************************YTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKEL*******************ALREEVQR**************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPSKTTGKQPMAVDIDDMPETPQHRGIHHRRAHSDTSFRFDDFLLFDPSDLDLSALDLPSPNPTPPRGVPMPLDSSEDSSSNSHGQKQQKQSQNPPKPKPINHLRSLSVDSDFFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHSNSMDGFEVESILGDGVKKAVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYxxxxxxxxxxxxxxxxxxxxxVTMLQRDxxxxxxxxxxxxxxxxxxxxxAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTNNQTHGQSRPNFMDFNQRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor VIP1 Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions.probableQ9MA75

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WT7, chain A
Confidence level:confident
Coverage over the Query: 182-237
View the alignment between query and template
View the model in PyMOL
Template: 2WT7, chain B
Confidence level:confident
Coverage over the Query: 169-250
View the alignment between query and template
View the model in PyMOL
Template: 1HJB, chain A
Confidence level:confident
Coverage over the Query: 228-249,264-278
View the alignment between query and template
View the model in PyMOL