Citrus Sinensis ID: 019163

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-----
MNPSKTTGKQPMAVDIDDMPETPQHRGIHHRRAHSDTSFRFDDFLLFDPSDLDLSALDLPSPNPTPPRGVPMPLDSSEDSSSNSHGQKQQKQSQNPPKPKPINHLRSLSVDSDFFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHSNSMDGFEVESILGDGVKKAVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTNNQTHGQSRPNFMDFNQRV
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccc
cccccccccccccccHHcccccccccccccccccccHEEccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHcccccccHccccccccccccccccccccccccccccccccc
mnpskttgkqpmavdiddmpetpqhrgihhrrahsdtsfrfddfllfdpsdldlsaldlpspnptpprgvpmpldssedsssnshgqkqqkqsqnppkpkpinhlrslsvdsdffdslglispasgggagnsaagaggggekrsyhrhsnsmdgfevesilgdgvkkavDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIatgqipaangnpfgrglppqfpshqqamhnfggpqtqqQQQQQqqqvpqpstnnqthgqsrpnfmdfnqrv
mnpskttgkqpmavdiDDMPETPQHRGIHHRRAHSDTSFRFDDFLLFDPSDLDLSALDLPSPNPTPPRGVPMPLDSSEDSSSNShgqkqqkqsqnppkpkPINHLRSLSVDSDFFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHSNSMDGFEVESILGDGVKKAVDRDRLAelalidpkrakrilanrqsaarskerkirytselerkVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTnnqthgqsrpnfmdfnqrv
MNPSKTTGKQPMAVDIDDMPETPQHRGIHHRRAHSDTSFRfddfllfdpsdldlsaldlpspNPTPPRGVPMPLdssedsssnshgqkqqkqsqnppkpkpINHlrslsvdsdffdslglISPasgggagnsaagaggggEKRSYHRHSNSMDGFEVESILGDGVKKAVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNFGGpqtqqqqqqqqqqvpqpstnnqtHGQSRPNFMDFNQRV
**************************************FRFDDFLLFD***************************************************************************************************************ILGDGVKKAVDRDRLAELALI*********************************************************************************************************************************************************************
************************************TSFRFDDFLLFDPS**********************************************************************************************************************************************************YTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKEL*******************ALREEVQR**************************************************************************
**********PMAVDIDDMPET***********HSDTSFRFDDFLLFDPSDLDLSALDLPSPNPTPPRGVPM***************************KPINHLRSLSVDSDFFDSLGLISPASG*********************HSNSMDGFEVESILGDGVKKAVDRDRLAELALIDPKRAKRILA**********RKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHN****************************QSRPNFMDFNQRV
***********************************DTSFRFDDFLLFDPSDLDLSALDL******************************************************FFD********************************************L*DGVKKAVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIP*****************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPSKTTGKQPMAVDIDDMPETPQHRGIHHRRAHSDTSFRFDDFLLFDPSDLDLSALDLPSPNPTPPRGVPMPLDSSEDSSSNSHGQKQQKQSQNPPKPKPINHLRSLSVDSDFFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHSNSMDGFEVESILGDGVKKAVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYxxxxxxxxxxxxxxxxxxxxxVTMLQRDxxxxxxxxxxxxxxxxxxxxxAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTNNQTHGQSRPNFMDFNQRV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query345 2.2.26 [Sep-21-2011]
Q9MA75341 Transcription factor VIP1 yes no 0.869 0.879 0.513 7e-77
Q04088398 Probable transcription fa no no 0.773 0.670 0.438 2e-50
Q69IL4380 Transcription factor RF2a no no 0.492 0.447 0.578 1e-47
Q6S4P4329 Transcription factor RF2b no no 0.640 0.671 0.525 4e-47
O35426267 X-box-binding protein 1 O yes no 0.249 0.322 0.367 0.0006
Q9M7Q5392 ABSCISIC ACID-INSENSITIVE no no 0.269 0.237 0.316 0.0006
Q99941 703 Cyclic AMP-dependent tran no no 0.185 0.091 0.375 0.0009
Q9R1S4267 X-box-binding protein 1 O yes no 0.249 0.322 0.367 0.0009
Q9SJN0442 Protein ABSCISIC ACID-INS no no 0.278 0.217 0.318 0.0009
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  287 bits (735), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 188/366 (51%), Positives = 219/366 (59%), Gaps = 66/366 (18%)

Query: 10  QPMAVDIDDMPETPQHRGIHHRRAHSDTSFR---FDDFLLFDPSDLDLSALDL------P 60
           Q +  +I+ MPE P+ R  HHRRA S+T F     DD LLFDPSD+D S+LD       P
Sbjct: 10  QTILSEIEHMPEAPRQRISHHRRARSETFFSGESIDDLLLFDPSDIDFSSLDFLNAPPPP 69

Query: 61  SPNPTPPRGVPMPLDSSEDSSS-----NSHGQKQQKQSQNPPKPKPI--NHLRSLSVDSD 113
             +   P+  PM +DS E SS+     NS           PPKP+     H+RS SVDSD
Sbjct: 70  QQSQQQPQASPMSVDSEETSSNGVVPPNSL----------PPKPEARFGRHVRSFSVDSD 119

Query: 114 FFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHS--NSMDG------FEVESILG--- 162
           FFD LG+                  G +K+  H HS  NSMDG      F +ESIL    
Sbjct: 120 FFDDLGVTEE--------KFIATSSGEKKKGNHHHSRSNSMDGEMSSASFNIESILASVS 171

Query: 163 --DGVKK--AVDRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQT 218
             D  KK   +  DRLAELAL+DPKRAKRILANRQSAARSKERKIRYT ELERKVQTLQ 
Sbjct: 172 GKDSGKKNMGMGGDRLAELALLDPKRAKRILANRQSAARSKERKIRYTGELERKVQTLQN 231

Query: 219 EATTLSAQVTMLQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQ 278
           EATTLSAQVTMLQR T+ L  ENK LK+RLQA+EQQA LRDALNEALR+E+ RLK+  G+
Sbjct: 232 EATTLSAQVTMLQRGTSELNTENKHLKMRLQALEQQAELRDALNEALRDELNRLKVVAGE 291

Query: 279 IPAANGNPFGRGLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTNNQTHGQSRPNF 338
           IP  NGN + R    QF S Q AM+ FG    QQ            STN Q    S P++
Sbjct: 292 IPQGNGNSYNRA---QFSSQQSAMNQFGNKTNQQM-----------STNGQP---SLPSY 334

Query: 339 MDFNQR 344
           MDF +R
Sbjct: 335 MDFTKR 340
Transcription activator that binds specifically to the VIP1 response elements (VREs) DNA sequence 5'-ACNGCT-3' found in some stress genes (e.g. TRX8 and MYB44), when phosphorylated/activated by MPK3. Required for Agrobacterium VirE2 nuclear import and tumorigenicity. Promotes transient expression of T-DNA in early stages by interacting with VirE2 in complex with the T-DNA and facilitating its translocation to the nucleus, and mediates stable genetic transformation by Agrobacterium by binding H2A histone. Prevents cell differentiation and shoot formation. Limits sulfate utilization efficiency (SUE) and sulfate uptake, especially in low-sulfur conditions.
Arabidopsis thaliana (taxid: 3702)
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function description
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function description
>sp|O35426|XBP1_MOUSE X-box-binding protein 1 OS=Mus musculus GN=Xbp1 PE=2 SV=2 Back     alignment and function description
>sp|Q9M7Q5|AI5L4_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 4 OS=Arabidopsis thaliana GN=ABF1 PE=1 SV=1 Back     alignment and function description
>sp|Q99941|ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens GN=ATF6B PE=1 SV=2 Back     alignment and function description
>sp|Q9R1S4|XBP1_RAT X-box-binding protein 1 OS=Rattus norvegicus GN=Xbp1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SJN0|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
118488783340 unknown [Populus trichocarpa] 0.950 0.964 0.677 1e-116
225463916350 PREDICTED: transcription factor VIP1-lik 0.930 0.917 0.667 1e-103
224085099330 predicted protein [Populus trichocarpa] 0.794 0.830 0.718 1e-101
449446510363 PREDICTED: transcription factor VIP1-lik 0.863 0.820 0.593 1e-83
397746431347 bZIP4 [Tamarix hispida] 0.944 0.939 0.575 2e-83
449443774351 PREDICTED: transcription factor VIP1-lik 0.834 0.820 0.595 2e-80
449475450357 PREDICTED: transcription factor VIP1-lik 0.924 0.893 0.554 1e-79
297846772343 vire2-interacting protein VIP1 [Arabidop 0.907 0.912 0.530 1e-79
351720971332 bZIP transcription factor bZIP131 [Glyci 0.910 0.945 0.573 2e-77
297735830195 unnamed protein product [Vitis vinifera] 0.547 0.969 0.81 7e-77
>gi|118488783|gb|ABK96202.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 242/357 (67%), Positives = 266/357 (74%), Gaps = 29/357 (8%)

Query: 1   MNPSKTTGKQPMAVDIDDMPETPQHRGIHHRRAHSDTSFRFDDFLLFDPSDLDLSALD-- 58
           M+P+K  GKQPM VDI+ MPETP +RG HHRRAHSDTSFRFDD L  D SD DLS+LD  
Sbjct: 1   MDPTKFRGKQPMTVDIEQMPETP-YRGSHHRRAHSDTSFRFDDLLFLDASDFDLSSLDDL 59

Query: 59  -------LPSPNPTPPRGVPMPLDS-SEDSSSNSHGQKQQKQSQNPPKPKPINHLRSLSV 110
                    +    PP   PM +DS S+DS+SN  GQ Q        KPKP+NHLRSLS+
Sbjct: 60  PTPNTTTTTTTTTHPPPAAPMAVDSLSDDSTSN--GQNQ--------KPKPVNHLRSLSM 109

Query: 111 DSDFFDSLGLISPASGGGAGNSAAGAGGGGEKRSYHRHSNSMDG-FEVESILGDGVKKAV 169
           DSDFFD LGL +        +  A AG       +HRHS SMDG FEV+SI+ DGVKKA+
Sbjct: 110 DSDFFDGLGLGAAGGADEKFDGKAVAGEKRAANPHHRHSYSMDGSFEVDSIMIDGVKKAM 169

Query: 170 DRDRLAELALIDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTM 229
             DRLAEL+LIDPKRAKRILANRQSAARSKERKIRYT ELERKVQTLQTEATTLSAQVTM
Sbjct: 170 APDRLAELSLIDPKRAKRILANRQSAARSKERKIRYTGELERKVQTLQTEATTLSAQVTM 229

Query: 230 LQRDTTGLTAENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGR 289
           LQRDTTGLT ENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQ+PA NGNPF R
Sbjct: 230 LQRDTTGLTVENKELKLRLQAMEQQAHLRDALNEALREEVQRLKIATGQVPAVNGNPFNR 289

Query: 290 GLPPQFPSHQQAMHNFGGPQTQQQQQQQQQQVPQPSTNNQTH-GQSRPNFMDFNQRV 345
           GLPPQF SH Q +  FG      QQ QQQ  +PQPST  QTH GQ  P+F +F+QRV
Sbjct: 290 GLPPQFSSH-QGLQTFGN-----QQAQQQLHMPQPSTTGQTHNGQPHPSFSNFSQRV 340

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225463916|ref|XP_002266803.1| PREDICTED: transcription factor VIP1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224085099|ref|XP_002307491.1| predicted protein [Populus trichocarpa] gi|222856940|gb|EEE94487.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449446510|ref|XP_004141014.1| PREDICTED: transcription factor VIP1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|397746431|gb|AFO63283.1| bZIP4 [Tamarix hispida] Back     alignment and taxonomy information
>gi|449443774|ref|XP_004139652.1| PREDICTED: transcription factor VIP1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449475450|ref|XP_004154456.1| PREDICTED: transcription factor VIP1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297846772|ref|XP_002891267.1| vire2-interacting protein VIP1 [Arabidopsis lyrata subsp. lyrata] gi|297337109|gb|EFH67526.1| vire2-interacting protein VIP1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|351720971|ref|NP_001237194.1| bZIP transcription factor bZIP131 [Glycine max] gi|113367224|gb|ABI34669.1| bZIP transcription factor bZIP131 [Glycine max] Back     alignment and taxonomy information
>gi|297735830|emb|CBI18550.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query345
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.472 0.478 0.657 8.8e-57
TAIR|locus:2061340398 AT2G31370 [Arabidopsis thalian 0.460 0.399 0.637 2e-49
TAIR|locus:2198856423 AT1G06070 "AT1G06070" [Arabido 0.463 0.378 0.614 4.2e-49
TAIR|locus:2061908367 AT2G40620 "AT2G40620" [Arabido 0.414 0.389 0.680 1.8e-48
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.426 0.436 0.662 4.5e-43
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.376 0.235 0.641 3e-37
TAIR|locus:2047082525 AT2G21230 "AT2G21230" [Arabido 0.330 0.217 0.666 5.7e-36
TAIR|locus:2057300294 UNE4 "unfertilized embryo sac 0.371 0.435 0.381 3.1e-19
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.304 0.327 0.466 4e-19
TAIR|locus:2057030264 AT2G12900 "AT2G12900" [Arabido 0.298 0.390 0.413 8.3e-19
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 524 (189.5 bits), Expect = 8.8e-57, Sum P(2) = 8.8e-57
 Identities = 119/181 (65%), Positives = 133/181 (73%)

Query:   141 EKRSYHRHS--NSMDG------FEVESILG-----DGVKK--AVDRDRLAELALIDPKRA 185
             +K+  H HS  NSMDG      F +ESIL      D  KK   +  DRLAELAL+DPKRA
Sbjct:   139 KKKGNHHHSRSNSMDGEMSSASFNIESILASVSGKDSGKKNMGMGGDRLAELALLDPKRA 198

Query:   186 KRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENKELK 245
             KRILANRQSAARSKERKIRYT ELERKVQTLQ EATTLSAQVTMLQR T+ L  ENK LK
Sbjct:   199 KRILANRQSAARSKERKIRYTGELERKVQTLQNEATTLSAQVTMLQRGTSELNTENKHLK 258

Query:   246 LRLQAMEQQAHLRDALNEALREEVQRLKIATGQIPAANGNPFGRGLPPQFPSHQQAMHNF 305
             +RLQA+EQQA LRDALNEALR+E+ RLK+  G+IP  NGN + R    QF S Q AM+ F
Sbjct:   259 MRLQALEQQAELRDALNEALRDELNRLKVVAGEIPQGNGNSYNRA---QFSSQQSAMNQF 315

Query:   306 G 306
             G
Sbjct:   316 G 316
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;IDA
GO:0005634 "nucleus" evidence=ISM;IDA;IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0045596 "negative regulation of cell differentiation" evidence=IDA
GO:0009294 "DNA mediated transformation" evidence=IDA
GO:0051170 "nuclear import" evidence=IDA
GO:0051019 "mitogen-activated protein kinase binding" evidence=IPI
GO:0008272 "sulfate transport" evidence=IMP
GO:0009970 "cellular response to sulfate starvation" evidence=IMP
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=RCA
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057300 UNE4 "unfertilized embryo sac 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MA75VIP1_ARATHNo assigned EC number0.51360.86950.8797yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.1__3729__AT1G43700.1
annotation not avaliable (343 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
smart0033865 smart00338, BRLZ, basic region leucin zipper 2e-14
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 9e-07
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
pfam08614194 pfam08614, ATG16, Autophagy protein 16 (ATG16) 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 0.003
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 66.8 bits (164), Expect = 2e-14
 Identities = 26/63 (41%), Positives = 38/63 (60%)

Query: 181 DPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAE 240
           D KR +R   NR++A RS+ERK     ELERKV+ L+ E   L  ++  L+R+   L +E
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 241 NKE 243
            +E
Sbjct: 63  LEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 345
smart0033865 BRLZ basic region leucin zipper. 99.39
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.28
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.06
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 99.06
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.05
KOG3584348 consensus cAMP response element binding protein an 98.95
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.77
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.1
KOG0837279 consensus Transcriptional activator of the JUN fam 97.81
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.17
KOG4571294 consensus Activating transcription factor 4 [Trans 97.09
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 96.9
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.5
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.39
KOG3119269 consensus Basic region leucine zipper transcriptio 96.37
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.53
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.51
PRK13169110 DNA replication intiation control protein YabA; Re 95.29
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.14
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.06
PRK10884206 SH3 domain-containing protein; Provisional 95.0
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.89
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 94.61
PRK1542279 septal ring assembly protein ZapB; Provisional 94.42
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.21
TIGR0244965 conserved hypothetical protein TIGR02449. Members 93.71
PF1374789 DUF4164: Domain of unknown function (DUF4164) 93.67
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 93.34
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 93.17
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 93.09
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 92.7
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 92.28
KOG4807593 consensus F-actin binding protein, regulates actin 92.06
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.95
TIGR0244965 conserved hypothetical protein TIGR02449. Members 91.94
COG4467114 Regulator of replication initiation timing [Replic 91.74
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 91.62
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.55
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.55
COG2433652 Uncharacterized conserved protein [Function unknow 91.45
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 91.45
PF10186302 Atg14: UV radiation resistance protein and autopha 91.36
PRK0029568 hypothetical protein; Provisional 91.31
PF14662193 CCDC155: Coiled-coil region of CCDC155 91.29
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 91.14
PRK0279372 phi X174 lysis protein; Provisional 90.98
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 90.98
PRK0211973 hypothetical protein; Provisional 90.93
PRK0073668 hypothetical protein; Provisional 90.9
PRK0432574 hypothetical protein; Provisional 90.89
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 90.74
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 90.61
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 90.61
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 90.45
PRK10884206 SH3 domain-containing protein; Provisional 90.35
PRK0440675 hypothetical protein; Provisional 90.34
PRK11637 428 AmiB activator; Provisional 90.05
PRK11637428 AmiB activator; Provisional 89.99
PRK09039343 hypothetical protein; Validated 89.87
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 89.85
PRK09039343 hypothetical protein; Validated 89.67
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 89.53
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 89.48
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 89.05
PRK0084677 hypothetical protein; Provisional 88.83
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 88.64
KOG0288 459 consensus WD40 repeat protein TipD [General functi 88.52
COG307479 Uncharacterized protein conserved in bacteria [Fun 88.45
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 88.42
COG4026290 Uncharacterized protein containing TOPRIM domain, 88.29
PRK04863 1486 mukB cell division protein MukB; Provisional 88.29
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 88.17
COG4942 420 Membrane-bound metallopeptidase [Cell division and 88.01
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 87.91
PF13851201 GAS: Growth-arrest specific micro-tubule binding 87.74
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 87.33
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.21
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 87.15
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 86.95
PF10186 302 Atg14: UV radiation resistance protein and autopha 86.95
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 86.81
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 86.35
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 86.21
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 86.09
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 85.9
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 85.8
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 85.67
PRK1542279 septal ring assembly protein ZapB; Provisional 85.59
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 85.5
PRK13169110 DNA replication intiation control protein YabA; Re 85.39
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 85.09
KOG1962216 consensus B-cell receptor-associated protein and r 85.08
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 85.07
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 84.88
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 84.8
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 84.79
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 84.58
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 84.48
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 84.46
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 84.43
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 84.39
PHA02562562 46 endonuclease subunit; Provisional 84.36
PRK05431 425 seryl-tRNA synthetase; Provisional 84.32
PF05700221 BCAS2: Breast carcinoma amplified sequence 2 (BCAS 84.28
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 83.9
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 83.63
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 83.6
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 83.48
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 83.17
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 83.11
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 83.08
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 83.07
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.61
PRK13922276 rod shape-determining protein MreC; Provisional 82.52
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 82.37
COG2433652 Uncharacterized conserved protein [Function unknow 82.32
PF15294278 Leu_zip: Leucine zipper 82.19
KOG0971 1243 consensus Microtubule-associated protein dynactin 82.03
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 81.33
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 81.11
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 81.09
PRK13922276 rod shape-determining protein MreC; Provisional 81.08
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 81.05
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 80.99
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 80.95
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 80.87
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 80.75
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 80.63
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 80.44
COG3883265 Uncharacterized protein conserved in bacteria [Fun 80.29
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.39  E-value=2.3e-12  Score=97.83  Aligned_cols=62  Identities=40%  Similarity=0.513  Sum_probs=56.6

Q ss_pred             cChHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q 019163          180 IDPKRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAEN  241 (345)
Q Consensus       180 ~DpKR~KRiLsNRESArRSReRKkqyIeELE~KVq~Lq~EN~~Ls~ql~~Lqr~~~~L~sEN  241 (345)
                      .|+|+.+|+++||+||++||+||+.|+.+||.+|..|+.+|..|..++..|..++..|..++
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            47899999999999999999999999999999999999999999999998777776666654

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF05700 BCAS2: Breast carcinoma amplified sequence 2 (BCAS2); InterPro: IPR008409 This family consists of several eukaryotic sequences of unknown function Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query345
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 3e-11
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 1e-10
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 1e-07
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 2e-07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 6e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 6e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-04
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 1e-05
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 2e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 2e-04
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 2e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 8e-04
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
 Score = 57.0 bits (138), Expect = 3e-11
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 7/68 (10%)

Query: 183 KRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDTTGLTAENK 242
           KR K +  NR +A+RS++++  +   LE+K + L +    L ++VT+L+        E  
Sbjct: 1   KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLR-------NEVA 53

Query: 243 ELKLRLQA 250
           +LK  L A
Sbjct: 54  QLKQLLLA 61
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.5
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.29
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.23
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.1
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.02
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.91
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.83
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.38
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.35
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.23
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.16
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.31
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 96.23
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.07
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 93.44
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.4
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 93.28
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.84
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.7
3cve_A72 Homer protein homolog 1; coiled coil, alternative 91.94
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 91.72
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 91.64
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 91.57
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.23
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 90.99
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 90.58
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.39
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 90.35
4ath_A83 MITF, microphthalmia-associated transcription fact 90.06
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 89.57
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 88.81
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 88.78
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 88.72
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.66
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 88.47
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.36
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 88.27
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 87.84
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 87.33
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 87.27
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.8
1deb_A54 APC protein, adenomatous polyposis coli protein; c 86.79
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 86.7
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 86.52
3m48_A33 General control protein GCN4; leucine zipper, synt 85.48
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 85.45
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 85.02
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 84.8
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 84.29
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 84.17
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 83.45
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 83.31
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 82.79
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 82.71
3cve_A72 Homer protein homolog 1; coiled coil, alternative 82.65
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 82.61
4ati_A118 MITF, microphthalmia-associated transcription fact 82.42
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 81.79
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 81.34
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 81.32
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 81.06
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 80.54
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.50  E-value=3.3e-14  Score=105.63  Aligned_cols=52  Identities=31%  Similarity=0.486  Sum_probs=49.0

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 019163          183 KRAKRILANRQSAARSKERKIRYTSELERKVQTLQTEATTLSAQVTMLQRDT  234 (345)
Q Consensus       183 KR~KRiLsNRESArRSReRKkqyIeELE~KVq~Lq~EN~~Ls~ql~~Lqr~~  234 (345)
                      ||.+|+++||+||++||+||++|+++||.+|..|+.||..|..++..|+..+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999999887654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query345
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 84.7
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 81.21
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=84.70  E-value=0.34  Score=36.24  Aligned_cols=26  Identities=15%  Similarity=0.298  Sum_probs=23.0

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHH
Q 019163          183 KRAKRILANRQSAARSKERKIRYTSE  208 (345)
Q Consensus       183 KR~KRiLsNRESArRSReRKkqyIeE  208 (345)
                      +-+||.=+|+.+|+++|.||....++
T Consensus        48 rDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          48 RKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            77888899999999999999987654
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure