Citrus Sinensis ID: 019351


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILPQKQLGRRSDIQKPNGSFVQ
ccccccEEEEcccHHHHHHHHHHHHcccCEcccccccccccccEEccHHHHHHHccccccccccccccccccccccccEEEccccEEEEEEccccEEEEEEEECccEEEEEccccccccccHHHHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccEEEEcccccHHHHHHHHHHHHcccCEEccccccEEEEcccccEEEEEEccEEEEEcEEEEcccccccccccccEEEEEEEEEcccccccccccCEEEEEcccccccccccccccccccc
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIP***DSHSVQVILPQKQLGRRSDIQKPNGSFV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGESSSLNLIQLWKRFRGNEQPPAHLGSSRDYNVDMIPKFIIANGALVRVLIHTDVTKYLYFKAVDGSFVYNKGKVHKVPATDMEALKSPLMGIFEKRRARKFFIYVQDYDENDPKTHEGMDLTRVTTRELIAKYGLDDNTIDFIGHALALHRDDRYLNEPALDTVKRMKLYAESIARFQGGSPYIYPLYGLGELPQAFARLSAVYGGTYMLNKPECKVEFDEEGKVVGVTSEGETAKCKKVVCDPSYLPNKVRKVGRVARAIAIMSHPIPNTNDSHSVQVILPQKQLGRRSDIQKPNGSFVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Rab GDP dissociation inhibitor alpha Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.probableP50398
Rab GDP dissociation inhibitor alpha Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.probableO97555
Rab GDP dissociation inhibitor alpha Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.probableP50396

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D5T, chain A
Confidence level:very confident
Coverage over the Query: 1-339
View the alignment between query and template
View the model in PyMOL