Citrus Sinensis ID: 019384

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--

MTAVHPPPTSGRELGNPPSDGISNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHGGPVLDCCFHDDSSGFSASADHTVRRLVFSHGKEDILGKHDAPVRCIEYSYAAGQVITGSWDKSLKCWDPRGASGQERTLVGTYPQPERVYSLSLVGNRLVVATAGRHVNVYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRLYQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVNEIEVKPKPKAYPNPPA

cccccccccccccccccccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEccccccEEEEEEcccccEEEECccccEEEEEcccccEEccccccccEEEEEEEccccEEEEECccccEEEEEcccccccccEEEECccccEEEEEEEccccEEEEEEcccEEEEEEccccccccEEEcccccccEEEEEEECcccEEEEEEccccEEEEEEEccccccccccccccccccccccccCEEEEEEEEcccccEEEEEcccccEEEEEccccccccccccccccEEEEEEcccccEEEEEEccccccccccccccEEEEEEcccccccccccccccccc

*****PPPTSGRELGNPPSDGISNLRFSNHSDHLLVSSWDKSVRLYDASANVLRGEFMHGGPVLDCCFHDDSSGFSASADHTVRRLVFSHGKEDILGKHDAPVRCIEYSYAAGQVITGSWDKSLKCWDPRGASGQERTLVGTYPQPERVYSLSLVGNRLVVATAGRHVNVYDLRNMSQP*QRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEASQAKKYAFKCHRKSEAGRDIVYPVNAIAFHPIYGTFATGGCDGFVNVWDGNNKKRLYQYSKYPTSIAALSFSRDGRLLAVASSYTFEEGDKPHEPDAIFVRSVNEIE*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mitotic checkpoint protein BUB3	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. Regulates chromosome segregation during oocyte meiosis. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1.	probable	Q1JQB2
Mitotic checkpoint protein BUB3	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1 (By similarity). Regulates chromosome segregation during oocyte meiosis.	probable	Q9WVA3
Mitotic checkpoint protein BUB3	Has a dual function in spindle-assembly checkpoint signaling and in promoting the establishment of correct kinetochore-microtubule (K-MT) attachments. Promotes the formation of stable end-on bipolar attachments. Necessary for kinetochore localization of BUB1. Regulates chromosome segregation during oocyte meiosis. The BUB1/BUB3 complex plays a role in the inhibition of anaphase-promoting complex or cyclosome (APC/C) when spindle-assembly checkpoint is activated and inhibits the ubiquitin ligase activity of APC/C by phosphorylating its activator CDC20. This complex can also phosphorylate MAD1L1.	probable	Q5RB58

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MMY, chain A
Confidence level:very confident
Coverage over the Query: 6-333
View the alignment between query and template
View the model in PyMOL