Citrus Sinensis ID: 019385

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
MSGMGDGYVGTAQDAVRIRRLEKQREAERRKIQELKTKSVSDKGQPGLLQFGSSTSEILETAFKKETVGLVTREEYVEKRVNIRNKIEEEEKEKLQKLLQEEEELQLEKRKKRKIKGNSRLSFADDFESENEEENGEIENLKTKRLAQAKLGKDPTVETSFLPDRGVEDDLSVRERQRSNLSVNGCSDSGFVSRSKFEPLQITYSYWDGAGHRRVIQVRKGDTIGEFLRAVQQQLAPEFREIRTTSVENLLYVKEDLIIPHQHSFYELIVNKARGKSGPLFHFDVHEDVRTIADATIEKDESHAGKVVERHWYEKNKHIFPASRWEIYDPTKKWERYTIHGD
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccccccccccccCCccccccccccEEccc
*********************************************************ILETAFKKETVGLVTREEYVEKRVN************************************************************************************************************FVSRSKFEPLQITYSYWDGAGHRRVIQVRKGDTIGEFLRAVQQQLAPEFREIRTTSVENLLYVKEDLIIPHQHSFYELIVNKARGKSGPLFHFDVHEDV************SHAGKVVERHWYEKNKHIFPASRWEIYDPTKKWERYTIH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGMGDGYVGTAQDAVRxxxxxxxxxxxxxxxxxxxxxSVSDKGQPGLLQFGSSTSEILETAFKKETVGLVTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSRLSFxxxxxxxxxxxxxxxxxxxxxRLAQAKLGKDPTVETSFLPDRGVEDDLSVRERQRSNLSVNGCSDSGFVSRSKFEPLQITYSYWDGAGHRRVIQVRKGDTIGEFLRAVQQQLAPEFREIRTTSVENLLYVKEDLIIPHQHSFYELIVNKARGKSGPLFHFDVHEDVRTIADATIEKDESHAGKVVERHWYEKNKHIFPASRWEIYDPTKKWERYTIHGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein XAP5 CIRCADIAN TIMEKEEPER Involved in light regulation of the circadian clock and photomorphogenesis.confidentQ69JZ7
Protein XAP5 CIRCADIAN TIMEKEEPER Involved in light regulation of the circadian clock and photomorphogenesis. May play a global role in coordinating growth in response to the light environment. Acts as a light quality sensor directing both negative and positive transcriptional regulation. Inhibits growth in red light but promote growth in blue light. Inhibits clock gene expression in diurnal cycles. Plays no role in the control of flowering time.confidentQ8H110
Protein XAP5 CIRCADIAN TIMEKEEPER Involved in light regulation of the circadian clock and photomorphogenesis.probableB8BDW1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 17-50,61-87
View the alignment between query and template
View the model in PyMOL