Citrus Sinensis ID: 019391


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MWDLNDSLKDIEESEACSSQKTSIDGDDEKGKQVGSVSNSSSSAVVIENGSDEEIGASERRLLSRSGGSKIFGVCLYQEAMEESEPEPPVTRQFFPVDFQEQQATSSEAGAGGLAFPRANWVGVKFCQSEPIVEAGKSVIEAPQPLKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDSGKQVYLGGFDTAHAAARAYDRAAIKFRGAEADINFSIEDYEDDLKQMSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEVEAARAYDRAAVKCNGKDAVTNFDPSLYQDELKASGKSLTMSWCRPQSRFEFGQFSF
cccccccccccccHccccccccccccccccccccccccccccccEEcccccccccccHHHHHccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccCEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHcccccccccccccccccECccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHccccccccccccccccccccccc
MWDLNDSL*************************************************************KIFGVCLYQ*********************************************************************************YRGVTFYRRTGRWESHIWDSGKQVYLGGFDTAHAAARAYDRAAIKFRGAEADINFSIEDYEDDLKQMSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEVEAARAYDRAAVKCNGKDAVTNFDPSLYQ****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWDLNDSLKDIEESEACSSQKTSIDGDDEKGKQVGSVSNSSSSAVVIENGSDEEIGASERRLLSRSGGSKIFGVCLYQEAMEESEPEPPVTRQFFPVDFQEQQATSSEAGAGGLAFPRANWVGVKFCQSEPIVEAGKSVIEAPQPLKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDSGKQVYLGGFDTAHAAARAYDRAAIKFRGAEADINFSIEDYEDDLKQMSNLTKEEFVHVLRRQSTGFPRGSSKYRGVTLHKCGRWEARMGQFLGKKYVYLGLFDTEVEAARAYDRAAVKCNGKDAVTNFDPSLYQDELKASGKSLTMSWCRPQSRFEFGQFSF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Floral homeotic protein APETALA 2 Probable transcriptional activator that promotes early floral meristem identity. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Plays a central role in the specification of floral identity, particularly for the normal development of sepals and petals in the wild-type flower. Acts as A class cadastral protein by repressing the C class floral homeotic gene AGAMOUS in association with other repressors like LEUNIG and SEUSS. It is also required during seed development.probableP47927

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 251-310
View the alignment between query and template
View the model in PyMOL
Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 159-217
View the alignment between query and template
View the model in PyMOL
Template: 3EIK, chain A
Confidence level:probable
Coverage over the Query: 158-298
View the alignment between query and template
View the model in PyMOL