Citrus Sinensis ID: 019425


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MFVLRVHSVDDNHPITIEEAGFCTVSSTATRSRANPNPKFSERRGLVHLFRGTSQSYQQNPNSRSTCIFVVAVPNYLSSDEFVRFCGSHIDHVEELIFIRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLATQLETQRQYYESLLAEAKSKRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTNTRRHKKSSRRKN
ccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccHHHHHHHHcccEEEEEccccEEEEcccccEEHHHHHccccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccCEEEEcccccccccccccccccccccc
*FVLRVHSVDDNHPITIEEAGFCTV*************KFSERRGLVHLFRG**********SRSTCIFVVAVPNYLSSDEFVRFCGSHIDHVEELIFIRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSP*********************ALFNSKVEAIVDEYNRLLATQLETQRQYYESLL*****************************LDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNM***********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVLRVHSVDDNHPITIEEAGFCTVSSTATRSRANPNPKFSERRGLVHLFRGTSQSYQQNPNSRSTCIFVVAVPNYLSSDEFVRFCGSHIDHVEELIFIRYKEGHAVRHWKDTQHWYSLDLRTQQIWDYVGDNYVHRLNQSKADGKLVEMNSPCMSHEAHCGTCECSEDSGISGALFNSKVEAIVDEYNRLLxxxxxxxxxxxxxxxxxxxxxRESLIPETVEKAVASKMQDIQNELDICEEAKKAVADVNSKLIKNQEIMRKKFKEIEEREITSLRLRDATILDLEEQIRDLTVYIEAQKTLTNMTDSDGIKGGTVLPVSYQQSSPTNTRRHKKSSRRKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I50, chain A
Confidence level:confident
Coverage over the Query: 85-150
View the alignment between query and template
View the model in PyMOL
Template: 3IHP, chain A
Confidence level:probable
Coverage over the Query: 60-137
View the alignment between query and template
View the model in PyMOL
Template: 3BAS, chain A
Confidence level:probable
Coverage over the Query: 226-297
View the alignment between query and template
View the model in PyMOL
Template: 3TNU, chain B
Confidence level:probable
Coverage over the Query: 226-256
View the alignment between query and template
View the model in PyMOL
Template: 1GS9, chain A
Confidence level:probable
Coverage over the Query: 184-263
View the alignment between query and template
View the model in PyMOL