Citrus Sinensis ID: 019428

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-

MKSKLGLCLGFLSQIDPNGNNFSFALLGSSLVISSMASARLQFSYGWYFTFIQGFVYLVLIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPADDKPIKRTATSSFKVNIRKLSFSEREEADEEKRAPV

cccccEEEEcccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHccccccccccccHHHHccccc

**SKLGLCLGFLSQIDPNGNNFSFALLGSSLVISSMASARLQFSYGWYFTFIQGFVYLVLIYLQGFTTKQMMNPWKTYVKLSAVLMGSHGLTKGSLAFLNYPAQLMFKSTKVLPVMVMGAFIPGLRRKYPAHEYVSALLLVVGLILFTLADAQTSPNFSMIGVIMISGALIMDSFLGNLQEAIFTMNPETTQMEMLFCSTVVGLPMLIPPMLLTGELFKAWNSCSQHLYVYGVLVFEAMATFIGQVSVLSLIALFGAATTAMVTTARKAVTLLLSYLIFTKPLTEQHGTGLLLIAMGITLKLLPAD***********************************

xxxxxxxxxxxxxxxxxxxxxHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxHHxxxHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UDP-galactose/UDP-glucose transporter 4	Sugar transporter involved in the transport of nucleotide-sugars from cytoplasm into the Golgi and/or the endoplasmic reticulum.	confident	Q9LDX3
UDP-galactose/UDP-glucose transporter 2	Sugar transporter involved in the transport of UDP-galactose form the cytoplasm into the Golgi apparatus.	probable	Q29Q28

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 79-151
View the alignment between query and template
View the model in PyMOL

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 236-304
View the alignment between query and template
View the model in PyMOL