Citrus Sinensis ID: 019435

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MGENMEKTVNKKHKGKHDKPKPWDEDPNIDHWKVEKFDPFWNEGGMLEVSSFSTLFPQYREKYLQEAWPMVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQILMVKKELEKDPALANENWDRFLPKFKKKNVKQKKVKSKEKKPYTPFPPPPQPSKIDKLLESGEYFLSERKKESKKWQEKQEKQAEKTAENKRKRDAAFIPPEEPSRQNSCEAEDKTNDVAAMAKSLKEKAKKLRKQKFAENINPEEYIAASGEKPSKKKKSK
cccccccccccccccccccccccccccccccccccccccccccccccEECcccccccHHHHHHHHHHHHHHHHHHHHHccEEEEEccccCEEEEcccccccHHHHHHHHHHHHHHHccccHHHHHHHcccccEEEEEEcccccccHHHHHHHHccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
***************************NIDHWKVEKFDPFWNEGGMLEVSSFSTLFPQYREKYLQEAWPMVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQILMVKKELEKDPALANENWDRFL*******************************KIDKLLE******************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGENMEKTVNKKHKGKHDKPKPWDEDPNIDHWKVEKFDPFWNEGGMLEVSSFSTLFPQYREKYLQEAWPMVKGALKEYGVSCELNLVEGSMTVSTTRKTRDPYIIVKARDLIRLLSRSVPAPQAIKILDDEMQCDIIKIGNLVRNKERFVKRRQHLVGPNSSTLKALEILTGCYILVQILMVKKELEKDPALANENWDRFLPKFKKKNVKQKKVKSKEKKPYTPFPPPPQPSKIDKLLESGEYFLSERKKESKKWQEKQEKQAEKTAENKRKRDAAFIPPEEPSRQNSCEAEDKxxxxxxxxxxxxxxxxxxxxxKFAENINPEEYIAASGEKPSKKKKSK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
KRR1 small subunit processome component homolog Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.probableO74777
KRR1 small subunit processome component homolog Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.probableQ54UU6
KRR1 small subunit processome component homolog Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly.probableQ3B7L9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3U, chain A
Confidence level:very confident
Coverage over the Query: 51-178
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 205-220,235-278
View the alignment between query and template
View the model in PyMOL